Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	255403
Gene name	Zinc finger protein 718
Gene symbol	ZNF718
Synonyms (NCBI Gene)	-
Chromosome	4
Chromosome location	4p16.3

Show/Hide all (59)

miRTarBase ID	miRNA	Experiments
MIRT1537582	hsa-miR-1184	CLIP-seq
MIRT1537583	hsa-miR-1205	CLIP-seq
MIRT1537584	hsa-miR-1297	CLIP-seq
MIRT1537585	hsa-miR-1305	CLIP-seq
MIRT1537586	hsa-miR-135a	CLIP-seq
MIRT1537587	hsa-miR-135b	CLIP-seq
MIRT1537588	hsa-miR-26a	CLIP-seq
MIRT1537589	hsa-miR-26b	CLIP-seq
MIRT1537590	hsa-miR-3065-5p	CLIP-seq
MIRT1537591	hsa-miR-3119	CLIP-seq
MIRT1537592	hsa-miR-3145-3p	CLIP-seq
MIRT1537593	hsa-miR-3158-5p	CLIP-seq
MIRT1537594	hsa-miR-3607-5p	CLIP-seq
MIRT1537595	hsa-miR-3692	CLIP-seq
MIRT1537596	hsa-miR-374a	CLIP-seq
MIRT1537597	hsa-miR-374b	CLIP-seq
MIRT1537598	hsa-miR-3915	CLIP-seq
MIRT1537599	hsa-miR-3925-3p	CLIP-seq
MIRT1537600	hsa-miR-3928	CLIP-seq
MIRT1537601	hsa-miR-421	CLIP-seq
MIRT1537602	hsa-miR-4307	CLIP-seq
MIRT1537603	hsa-miR-4426	CLIP-seq
MIRT1537604	hsa-miR-4465	CLIP-seq
MIRT1537605	hsa-miR-4493	CLIP-seq
MIRT1537606	hsa-miR-4499	CLIP-seq
MIRT1537607	hsa-miR-4501	CLIP-seq
MIRT1537608	hsa-miR-4504	CLIP-seq
MIRT1537609	hsa-miR-4643	CLIP-seq
MIRT1537610	hsa-miR-4647	CLIP-seq
MIRT1537611	hsa-miR-4662b	CLIP-seq
MIRT1537612	hsa-miR-4712-5p	CLIP-seq
MIRT1537613	hsa-miR-4729	CLIP-seq
MIRT1537614	hsa-miR-4732-5p	CLIP-seq
MIRT1537615	hsa-miR-4753-3p	CLIP-seq
MIRT1537616	hsa-miR-4768-5p	CLIP-seq
MIRT1537617	hsa-miR-4773	CLIP-seq
MIRT1537618	hsa-miR-513c	CLIP-seq
MIRT1537619	hsa-miR-514b-5p	CLIP-seq
MIRT1537620	hsa-miR-542-3p	CLIP-seq
MIRT1537621	hsa-miR-548u	CLIP-seq
MIRT1537622	hsa-miR-576-3p	CLIP-seq
MIRT1537623	hsa-miR-7	CLIP-seq
MIRT1537624	hsa-miR-766	CLIP-seq
MIRT1537625	hsa-miR-770-5p	CLIP-seq
MIRT1537626	hsa-miR-802	CLIP-seq
MIRT1537594	hsa-miR-3607-5p	CLIP-seq
MIRT1537599	hsa-miR-3925-3p	CLIP-seq
MIRT1537612	hsa-miR-4712-5p	CLIP-seq
MIRT1537614	hsa-miR-4732-5p	CLIP-seq
MIRT1537616	hsa-miR-4768-5p	CLIP-seq
MIRT1537624	hsa-miR-766	CLIP-seq
MIRT1537625	hsa-miR-770-5p	CLIP-seq
MIRT1537599	hsa-miR-3925-3p	CLIP-seq
MIRT1537612	hsa-miR-4712-5p	CLIP-seq
MIRT1537614	hsa-miR-4732-5p	CLIP-seq
MIRT1537616	hsa-miR-4768-5p	CLIP-seq
MIRT1537624	hsa-miR-766	CLIP-seq
MIRT1537625	hsa-miR-770-5p	CLIP-seq
MIRT1537594	hsa-miR-3607-5p	CLIP-seq

Show/Hide all (9)

GO ID	Ontology	Definition	Evidence
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0003677	Function	DNA binding	IEA
GO:0005634	Component	Nucleus	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IBA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0046872	Function	Metal ion binding	IEA

MIM	HGNC	e!Ensembl
HGNC	N/A	HGNC

Q3SXZ3

Protein name

Zinc finger protein 718

Protein function

May be involved in transcriptional regulation.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01352	KRAB	3 → 44	KRAB box	Family
PF13912	zf-C2H2_6	170 → 196		Domain
PF00096	zf-C2H2	227 → 249	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	255 → 277	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	283 → 305	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	311 → 333	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	339 → 361	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	367 → 389	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	395 → 417	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	423 → 445	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	451 → 473	Zinc finger, C2H2 type	Domain

Sequence

MELLTFKDVAIEFSPEEWKCLDTSQQNLYRDVMLENYRNLVSLGVSISNPDLVTSLEQRK
EPYNLKIHETAARPPAVCSHFTQNLWTVQGIEDSFHKLIPKGHEKRGHENLRKTCKSINE
CKVQKGGYNRINQCLLTTQKKTIQSNICVKVFHKFSNSNKDKIRYTGDKTFKCKECGKSF
HVLSRLTQHKRIHTGENPYTCEECGKAFNWSSILTKHKRIHAREKFYKCEECGKGFTRSS
HLTKHKRIHTGEKPYICEKCGKAFNQSSTLNLHKRIHSAQKYYKCEECGKAFKWSSSLNE
HKRIHAGEKPFSCEECGNVFTTSSDFAKHKRIHTGEKPYKCEECGKSFNRSTTLTTHKRI
HTGEKPYTCEECGKAFNWSSTLNVHKRIHSGKNPYKCEDCGKAFKVFANLHNHKKIHTGE
KPYICKQCGKAFKQSSHLNKHKKIHTVDKPYKCKECGKAFKQYSNLPQHKRTHTGGKF

Sequence length

478

Interactions

View interactions

	Reactome
			Generic Transcription Pathway

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BARTHOLIN DUCT CYST	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BARTHOLIN GLAND DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VENOUS THROMBOEMBOLISM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (3)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Asthma	Associate	25288825	★★★★★ ★☆☆☆☆ Found in Text Mining only
Distal Myopathies	Associate	38015635	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pain	Associate	38015635	★★★★★ ★☆☆☆☆ Found in Text Mining only

ZNF718 (zinc finger protein 718)