Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
2551
Gene name Gene Name - the full gene name approved by the HGNC.
GA binding protein transcription factor subunit alpha
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
GABPA
Synonyms (NCBI Gene) Gene synonyms aliases
E4TF1-60, E4TF1A, NFT2, NRF2, NRF2A, RCH04A07
Chromosome Chromosome number
21
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
21q21.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes one of three GA-binding protein transcription factor subunits which functions as a DNA-binding subunit. Since this subunit shares identity with a subunit encoding the nuclear respiratory factor 2 gene, it is likely involved in activation
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT031329 hsa-miR-18a-5p Sequencing 20371350
MIRT048948 hsa-miR-92a-3p CLASH 23622248
MIRT297783 hsa-miR-497-5p PAR-CLIP 20371350
MIRT297779 hsa-miR-16-5p PAR-CLIP 20371350
MIRT297781 hsa-miR-195-5p PAR-CLIP 20371350
Transcription factors
Transcription factor Regulation Reference
ATF1 Unknown 10585419
CREB1 Unknown 10585419
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IEA
GO:0000785 Component Chromatin IDA 22306510
GO:0000785 Component Chromatin ISA
GO:0000976 Function Transcription regulatory region sequence-specific DNA binding IDA 9857059
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IDA 12750007, 22306510
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
600609 4071 ENSG00000154727
Protein
UniProt ID Q06546
Protein name GA-binding protein alpha chain (GABP subunit alpha) (Nuclear respiratory factor 2 subunit alpha) (Transcription factor E4TF1-60)
Protein function Transcription factor capable of interacting with purine rich repeats (GA repeats). Positively regulates transcription of transcriptional repressor RHIT/ZNF205 (PubMed:22306510). ; (Microbial infection) Nec
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF11620 GABP-alpha 36 119 GA-binding protein alpha chain Family
PF02198 SAM_PNT 170 251 Sterile alpha motif (SAM)/Pointed domain Domain
PF00178 Ets 321 400 Ets-domain Domain
Sequence
MTKREAEELIEIEIDGTEKAECTEESIVEQTYAPAECVSQAIDINEPIGNLKKLLEPRLQ
CSLDAHEICLQDIQLDPERSLFDQGVKTDGTVQLSVQVISYQGIEPKLNILEIVKPADT
V
EVVIDPDAHHAESEAHLVEEAQVITLDGTKHITTISDETSEQVTRWAAALEGYRKEQERL
GIPYDPIQWSTDQVLHWVVWVMKEFSMTDIDLTTLNISGRELCSLNQEDFFQRVPRGEIL
WSHLELLRKYV
LASQEQQMNEIVTIDQPVQIIPASVQSATPTTIKVINSSAKAAKVQRAP
RISGEDRSSPGNRTGNNGQIQLWQFLLELLTDKDARDCISWVGDEGEFKLNQPELVAQKW
GQRKNKPTMNYEKLSRALRYYYDGDMICKVQGKRFVYKFV
CDLKTLIGYSAAELNRLVTE
CEQKKLAKMQLHGIAQPVTAVALATASLQTEKDN
Sequence length 454
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Transcriptional activation of mitochondrial biogenesis
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Unknown
Disease term Disease name Evidence References Source
Mental depression Depressive disorder 23623252 ClinVar
Associations from Text Mining
Disease Name Relationship Type References
Adenocarcinoma Follicular Associate 32163919
Breast Neoplasms Associate 26517092, 7914192
Carcinoma Hepatocellular Associate 35958019
COVID 19 Associate 37373377
Dyspnea Inhibit 37373377
Endometrial Neoplasms Inhibit 34306255
Hyperlipidemia Familial Combined Associate 18230803
Leukemia Myelogenous Chronic BCR ABL Positive Associate 26072332
Melanoma Associate 28108517
Metabolic Diseases Associate 18230803