MORN5 (MORN repeat containing 5)

Gene
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
254956
Gene name Gene Name - the full gene name approved by the HGNC.
MORN repeat containing 5
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
MORN5
Synonyms (NCBI Gene) Gene synonyms aliases
C9orf113, C9orf18
Chromosome Chromosome number
9
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
9q33.2
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(9)
miRTarBase ID miRNA Experiments Reference
MIRT1155693 hsa-miR-1827 CLIP-seq
MIRT1155694 hsa-miR-3165 CLIP-seq
MIRT1155695 hsa-miR-3612 CLIP-seq
MIRT1155696 hsa-miR-4299 CLIP-seq
MIRT1155697 hsa-miR-4443 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(1)
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 32296183
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
619837 17841 ENSG00000185681
Protein
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Q5VZ52
Protein name MORN repeat-containing protein 5
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02493 MORN 8 → 30 MORN repeat Repeat
PF02493 MORN 31 → 53 MORN repeat Repeat
PF02493 MORN 54 → 75 MORN repeat Repeat
Tissue specificity TISSUE SPECIFICITY: Expressed in sperm (at protein level). {ECO:0000269|PubMed:28742876}.
Sequence 
MEYTGSKYIGEYVDGRMEGKAKYILPTETIYVGEMKDGMFHGEGTLYFPSGSQYDAIWEN
GLAIKGTYTFSDGLHYDEKNWHYCDGYDRRFYTEILNGLKPAGMAQLTNMDPPRKIPKGY
YDCGDGFYNPVTRVVKDYRNRFLRNADDDEHEWITRTCRKG
Sequence length 161
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Causal Diseases (1)
Causal
Disease term Disease name dbSNP ID References
Lung carcinoma Squamous cell carcinoma of lung rs1805076, rs121909071, rs121913530, rs112445441, rs121913529, rs121913535, rs121913297, rs121913279, rs104886003, rs397516975, rs11554290, rs121913364, rs121913351, rs121913369, rs121913355
View all (44 more)		 31326317
Show/Hide Text Mining Associations (2)
Associations from Text Mining
Disease Name Relationship Type References
Lung Neoplasms Associate 32045668
Neoplasms Associate 32045668