MORN5 (MORN repeat containing 5)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein
Entrez ID 254956
Gene name MORN repeat containing 5
Gene symbol MORN5
Synonyms (NCBI Gene)
C9orf113C9orf18
Chromosome 9
Chromosome location 9q33.2
miRNA miRNA information provided by mirtarbase database.
9
Gene miRNA Gene ontology Other IDs Protein
Show/Hide all (9)
miRTarBase ID miRNA Experiments Reference
MIRT1155693 hsa-miR-1827 CLIP-seq
MIRT1155694 hsa-miR-3165 CLIP-seq
MIRT1155695 hsa-miR-3612 CLIP-seq
MIRT1155696 hsa-miR-4299 CLIP-seq
MIRT1155697 hsa-miR-4443 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
6
Gene miRNA Gene ontology Other IDs Protein
Show/Hide all (6)
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 32296183
GO:0005929 Component Cilium IEA
GO:0031514 Component Motile cilium IEA
GO:0036126 Component Sperm flagellum IEA
GO:0036126 Component Sperm flagellum ISS
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein
MIM HGNC e!Ensembl
619837 17841 ENSG00000185681
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q5VZ52
Protein name MORN repeat-containing protein 5
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02493 MORN 8 → 30 MORN repeat Repeat
PF02493 MORN 31 → 53 MORN repeat Repeat
PF02493 MORN 54 → 75 MORN repeat Repeat
Tissue specificity TISSUE SPECIFICITY: Expressed in sperm (at protein level). {ECO:0000269|PubMed:28742876}.
Sequence 
MEYTGSKYIGEYVDGRMEGKAKYILPTETIYVGEMKDGMFHGEGTLYFPSGSQYDAIWEN
GLAIKGTYTFSDGLHYDEKNWHYCDGYDRRFYTEILNGLKPAGMAQLTNMDPPRKIPKGY
YDCGDGFYNPVTRVVKDYRNRFLRNADDDEHEWITRTCRKG
Sequence length 161
Interactions View interactions