Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
2549
Gene name Gene Name - the full gene name approved by the HGNC.
GRB2 associated binding protein 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
GAB1
Synonyms (NCBI Gene) Gene synonyms aliases
DFNB26
Disease Acronyms (UniProt) Disease acronyms from UniProt database
DFNB26
Chromosome Chromosome number
4
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
4q31.21
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a member of the IRS1-like multisubstrate docking protein family. It is an important mediator of branching tubulogenesis and plays a central role in cellular growth response, transformation and apoptosis. Two transcript
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs1553950635 G>A Pathogenic Coding sequence variant, missense variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT041177 hsa-miR-181d-5p CLASH 23622248
MIRT164203 hsa-miR-106b-5p HITS-CLIP 22473208
MIRT164198 hsa-miR-20a-5p HITS-CLIP 22473208
MIRT164203 hsa-miR-106b-5p HITS-CLIP 22473208
MIRT031364 hsa-miR-17-5p HITS-CLIP 22473208
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001525 Process Angiogenesis IMP 17178724
GO:0005515 Function Protein binding IPI 9658397, 10978177, 11323411, 11453982, 12475979, 12855672, 14665621, 14701753, 15574420, 15985432, 16638574, 19167335, 19380743, 20308328, 20473329, 20936779, 21278788, 22536782, 23397142, 24658140, 24728074, 25241761, 25416956, 29408807, 31585087, 31980649
GO:0005829 Component Cytosol TAS
GO:0005911 Component Cell-cell junction IMP 26706435
GO:0007173 Process Epidermal growth factor receptor signaling pathway TAS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
604439 4066 ENSG00000109458
Protein
UniProt ID Q13480
Protein name GRB2-associated-binding protein 1 (GRB2-associated binder 1) (Growth factor receptor bound protein 2-associated protein 1)
Protein function Adapter protein that plays a role in intracellular signaling cascades triggered by activated receptor-type kinases. Plays a role in FGFR1 signaling. Probably involved in signaling by the epidermal growth factor receptor (EGFR) and the insulin re
PDB 4QSY
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00169 PH 6 116 PH domain Domain
Sequence
MSGGEVVCSGWLRKSPPEKKLKRYAWKRRWFVLRSGRLTGDPDVLEYYKNDHAKKPIRII
DLNLCQQVDAGLTFNKKEFENSYIFDINTIDRIFYLVADSEEEMNKWVRCICDICG
FNPT
EEDPVKPPGSSLQAPADLPLAINTAPPSTQADSSSATLPPPYQLINVPPHLETLGIQEDP
QDYLLLINCQSKKPEPTRTHADSAKSTSSETDCNDNVPSHKNPASSQSKHGMNGFFQQQM
IYDSPPSRAPSASVDSSLYNLPRSYSHDVLPKVSPSSTEADGELYVFNTPSGTSSVETQM
RHVSISYDIPPTPGNTYQIPRTFPEGTLGQTSKLDTIPDIPPPRPPKPHPAHDRSPVETC
SIPRTASDTDSSYCIPTAGMSPSRSNTISTVDLNKLRKDASSQDCYDIPRAFPSDRSSSL
EGFHNHFKVKNVLTVGSVSSEELDENYVPMNPNSPPRQHSSSFTEPIQEANYVPMTPGTF
DFSSFGMQVPPPAHMGFRSSPKTPPRRPVPVADCEPPPVDRNLKPDRKVKPAPLEIKPLP
EWEELQAPVRSPITRSFARDSSRFPMSPRPDSVHSTTSSSDSHDSEENYVPMNPNLSSED
PNLFGSNSLDGGSSPMIKPKGDKQVEYLDLDLDSGKSTPPRKQKSSGSGSSVADERVDYV
VVDQQKTLALKSTREAWTDGRQSTESETPAKSVK
Sequence length 694
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  EGFR tyrosine kinase inhibitor resistance
ErbB signaling pathway
Ras signaling pathway
Phospholipase D signaling pathway
Neurotrophin signaling pathway
Bacterial invasion of epithelial cells
Proteoglycans in cancer
Renal cell carcinoma
Hepatocellular carcinoma
Gastric cancer
  PI3K Cascade
Constitutive Signaling by Ligand-Responsive EGFR Cancer Variants
PIP3 activates AKT signaling
GAB1 signalosome
PI3K events in ERBB2 signaling
Constitutive Signaling by Aberrant PI3K in Cancer
Constitutive Signaling by EGFRvIII
PI-3K cascade:FGFR1
PI-3K cascade:FGFR2
PI-3K cascade:FGFR3
PI-3K cascade:FGFR4
Signaling by FGFR2 in disease
Signaling by FGFR4 in disease
Signaling by FGFR1 in disease
PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling
MET activates PI3K/AKT signaling
Signaling by FGFR3 fusions in cancer
Signaling by FGFR3 point mutants in cancer
RET signaling
MET activates PTPN11
MET activates RAP1 and RAC1
MET receptor recycling
Erythropoietin activates Phosphoinositide-3-kinase (PI3K)
Signaling by ERBB2 KD Mutants
Signaling by ERBB2 ECD mutants
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Breast cancer Malignant neoplasm of breast rs587776547, rs1137887, rs137853007, rs587776650, rs80359351, rs80359714, rs121917783, rs104886456, rs121964878, rs80359874, rs80357868, rs80357508, rs387906843, rs80357569, rs80358158
View all (309 more)
Deafness DEAFNESS, AUTOSOMAL RECESSIVE 26 rs267607135, rs387906219, rs387906220, rs387906221, rs387906222, rs606231120, rs267606855, rs121918370, rs137853185, rs137853186, rs137853187, rs137853188, rs587776522, rs587776523, rs200781822
View all (1019 more)
29408807
Hearing loss Sensorineural Hearing Loss (disorder) rs267607135, rs267606855, rs779841884, rs267606854, rs28942097, rs121908073, rs121908076, rs74315289, rs121908144, rs111033313, rs74315437, rs121908348, rs121908349, rs121908350, rs397515359
View all (184 more)
Leukemia Leukemia, Myelocytic, Acute rs121909646, rs121913488, rs587776834, rs752746786, rs869312821, rs767454740, rs1554564297 27903959
Unknown
Disease term Disease name Evidence References Source
Asthma Asthma 21804548 ClinVar, GWAS
Nasopharyngeal Carcinoma Nasopharyngeal Carcinoma These data suggest that KAT7 can contribute NPC cell growth and survival through up-regulation of NPC-essential genes. GWAS, CBGDA
Breast Cancer Breast Cancer Importantly, breast cancer patients bearing PRC2 LOF mutations displayed significantly worse prognosis compared with PRC2 wild-type patients GWAS, CBGDA
Glioblastoma Glioblastoma CRISPR screening of E3 ubiquitin ligases reveals Ring Finger Protein 185 as a novel tumor suppressor in glioblastoma repressed by promoter hypermethylation and miR-587 GWAS, CBGDA
Associations from Text Mining
Disease Name Relationship Type References
Arteriosclerosis Obliterans Associate 33323827
Asthma Associate 25586491, 38057792
Atrophy Associate 17211494
Biliary Tract Neoplasms Associate 25217982
Blau syndrome Associate 38057792
Carcinogenesis Associate 16687399, 27302321
Carcinoma Hepatocellular Associate 24391994, 40159482
Carcinoma Non Small Cell Lung Associate 24662916, 27530552, 30280777
Carcinoma Ovarian Epithelial Associate 27302321
Cholangiocarcinoma Associate 26014518