Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
2548
Gene name Gene Name - the full gene name approved by the HGNC.
Alpha glucosidase
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
GAA
Synonyms (NCBI Gene) Gene synonyms aliases
LYAG
Chromosome Chromosome number
17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
17q25.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes lysosomal alpha-glucosidase, which is essential for the degradation of glycogen to glucose in lysosomes. The encoded preproprotein is proteolytically processed to generate multiple intermediate forms and the mature form of the enzyme. De
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs1800309 G>A,C Benign-likely-benign, other, pathogenic, benign Coding sequence variant, genic downstream transcript variant, missense variant
rs1800312 G>A,C Pathogenic, pathogenic-likely-pathogenic Coding sequence variant, genic downstream transcript variant, stop gained, missense variant
rs2229224 G>A,T Conflicting-interpretations-of-pathogenicity Coding sequence variant, genic downstream transcript variant, missense variant
rs2304846 G>A Conflicting-interpretations-of-pathogenicity, uncertain-significance Coding sequence variant, genic downstream transcript variant, synonymous variant
rs28937909 G>A,T Pathogenic Genic downstream transcript variant, missense variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT079203 hsa-miR-92a-3p HITS-CLIP 22473208
MIRT079207 hsa-miR-92b-3p HITS-CLIP 22473208
MIRT079202 hsa-miR-32-5p HITS-CLIP 22473208
MIRT1009120 hsa-miR-1228 CLIP-seq
MIRT1009121 hsa-miR-125a-3p CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000023 Process Maltose metabolic process IC 9505277
GO:0002026 Process Regulation of the force of heart contraction IEA
GO:0002086 Process Diaphragm contraction IEA
GO:0002086 Process Diaphragm contraction IMP 16917947
GO:0003007 Process Heart morphogenesis IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
606800 4065 ENSG00000171298
Protein
UniProt ID P10253
Protein name Lysosomal alpha-glucosidase (EC 3.2.1.20) (Acid maltase) (Aglucosidase alfa) [Cleaved into: 76 kDa lysosomal alpha-glucosidase; 70 kDa lysosomal alpha-glucosidase]
Protein function Essential for the degradation of glycogen in lysosomes (PubMed:14695532, PubMed:18429042, PubMed:1856189, PubMed:7717400). Has highest activity on alpha-1,4-linked glycosidic linkages, but can also hydrolyze alpha-1,6-linked glucans (PubMed:2906
PDB 5KZW , 5KZX , 5NN3 , 5NN4 , 5NN5 , 5NN6 , 5NN8 , 7P2Z , 7P32
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00088 Trefoil 82 130 Trefoil (P-type) domain Domain
PF16863 NtCtMGAM_N 147 253 N-terminal barrel of NtMGAM and CtMGAM, maltase-glucoamylase Domain
PF13802 Gal_mutarotas_2 254 320 Galactose mutarotase-like Domain
PF01055 Glyco_hydro_31 340 824 Glycosyl hydrolases family 31 Family
Sequence
MGVRHPPCSHRLLAVCALVSLATAALLGHILLHDFLLVPRELSGSSPVLEETHPAHQQGA
SRPGPRDAQAHPGRPRAVPTQCDVPPNSRFDCAPDKAITQEQCEARGCCYIPAKQGLQGA
QMGQPWCFFP
PSYPSYKLENLSSSEMGYTATLTRTTPTFFPKDILTLRLDVMMETENRLH
FTIKDPANRRYEVPLETPHVHSRAPSPLYSVEFSEEPFGVIVRRQLDGRVLLNTTVAPLF
FADQFLQLSTSLP
SQYITGLAEHLSPLMLSTSWTRITLWNRDLAPTPGANLYGSHPFYLA
LEDGGSAHGVFLLNSNAMDV
VLQPSPALSWRSTGGILDVYIFLGPEPKSVVQQYLDVVGY
PFMPPYWGLGFHLCRWGYSSTAITRQVVENMTRAHFPLDVQWNDLDYMDSRRDFTFNKDG
FRDFPAMVQELHQGGRRYMMIVDPAISSSGPAGSYRPYDEGLRRGVFITNETGQPLIGKV
WPGSTAFPDFTNPTALAWWEDMVAEFHDQVPFDGMWIDMNEPSNFIRGSEDGCPNNELEN
PPYVPGVVGGTLQAATICASSHQFLSTHYNLHNLYGLTEAIASHRALVKARGTRPFVISR
STFAGHGRYAGHWTGDVWSSWEQLASSVPEILQFNLLGVPLVGADVCGFLGNTSEELCVR
WTQLGAFYPFMRNHNSLLSLPQEPYSFSEPAQQAMRKALTLRYALLPHLYTLFHQAHVAG
ETVARPLFLEFPKDSSTWTVDHQLLWGEALLITPVLQAGKAEVTGYFPLGTWYDLQTVPV
EALGSLPPPPAAPREPAIHSEGQWVTLPAPLDTINVHLRAGYII
PLQGPGLTTTESRQQP
MALAVALTKGGEARGELFWDDGESLEVLERGAYTQVIFLARNNTIVNELVRVTSEGAGLQ
LQKVTVLGVATAPQQVLSNGVPVSNFTYSPDTKVLDICVSLLMGEQFLVSWC
Sequence length 952
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Lysosome
  Glycogen storage disease type II (GAA)
Neutrophil degranulation
Glycogen breakdown (glycogenolysis)
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Glycogen Storage Disease Glycogen storage disease II, adult form, Glycogen storage disease, type II, Glycogen storage disease, type IV, glycogen storage disease type ii, infantile rs121907945, rs1057517148, rs1475559733, rs886043343, rs914396317, rs1057517165, rs1555601802, rs786204720, rs1555599586, rs1555600575, rs796051877, rs767409395, rs2039192386, rs121907937, rs1057516546
View all (212 more)
N/A
Myopathy myopathy rs386834236 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
cardiomyopathy Cardiomyopathy N/A N/A ClinVar
Cardiomyopathy Primary dilated cardiomyopathy N/A N/A ClinVar
Hypertrophic cardiomyopathy hypertrophic cardiomyopathy N/A N/A ClinVar
Long QT Syndrome long qt syndrome N/A N/A ClinVar
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Antiphospholipid Syndrome Associate 30711607
Aphasia Broca Associate 38150853
Ataxia Associate 38150853
Atrial Fibrillation Associate 37087815
Cardiomegaly Inhibit 23570273
Cardiomyopathies Associate 25488666, 31342611, 36572041, 8815938
Cardiomyopathy Hypertrophic Associate 31875618, 37087815
Cerebellar Ataxia Associate 38150853
Cerebral Infarction Associate 32126021
Congenital Disorders of Glycosylation Associate 36579437