Gene Gene information from NCBI Gene database.
Entrez ID 2543
Gene name G antigen 1
Gene symbol GAGE1
Synonyms (NCBI Gene)
CT4.1CT4.4GAGE-1GAGE-4GAGE4
Chromosome X
Chromosome location Xp11.23
Summary This gene belongs to a family of genes that are expressed in a variety of tumors but not in normal tissues, except for the testis. The sequences of the family members are highly related but differ by scattered nucleotide substitutions. The antigenic pepti
miRNA miRNA information provided by mirtarbase database.
170
miRTarBase ID miRNA Experiments Reference
MIRT018221 hsa-miR-335-5p Microarray 18185580
MIRT445285 hsa-miR-3681-5p PAR-CLIP 22100165
MIRT445283 hsa-miR-6849-5p PAR-CLIP 22100165
MIRT445282 hsa-miR-135a-5p PAR-CLIP 22100165
MIRT445281 hsa-miR-135b-5p PAR-CLIP 22100165
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
3
GO ID Ontology Definition Evidence Reference
GO:0003674 Function Molecular_function ND
GO:0005575 Component Cellular_component ND
GO:0008150 Process Biological_process ND
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
300594 4098 ENSG00000205777
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P0DTW1
Protein name G antigen 1 (GAGE-1) (Antigen MZ2-F) (Cancer/testis antigen 4.1) (CT4.1)
Protein function Antigen, recognized on melanoma by autologous cytolytic T-lymphocytes.
Family and domains
Tissue specificity TISSUE SPECIFICITY: Expressed in a variety of tumor tissues but not in normal tissues, except testis. {ECO:0000269|PubMed:7544395}.
Sequence
MSWRGRSTYYWPRPRRYVQPPEMIGPMRPEQFSDEVEPATPEEGEPATQRQDPAAAQEGE
DEGASAGQGPKPEADSQEQGHPQTGCECEDGPDGQEMDPPNPEEVKTPEEGEGQSQC
Sequence length 117
Interactions View interactions