Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
2543
Gene name Gene Name - the full gene name approved by the HGNC.
G antigen 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
GAGE1
Synonyms (NCBI Gene) Gene synonyms aliases
CT4.1, CT4.4, GAGE-1, GAGE-4, GAGE4
Chromosome Chromosome number
X
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
Xp11.23
Summary Summary of gene provided in NCBI Entrez Gene.
This gene belongs to a family of genes that are expressed in a variety of tumors but not in normal tissues, except for the testis. The sequences of the family members are highly related but differ by scattered nucleotide substitutions. The antigenic pepti
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT018221 hsa-miR-335-5p Microarray 18185580
MIRT445285 hsa-miR-3681-5p PAR-CLIP 22100165
MIRT445283 hsa-miR-6849-5p PAR-CLIP 22100165
MIRT445282 hsa-miR-135a-5p PAR-CLIP 22100165
MIRT445281 hsa-miR-135b-5p PAR-CLIP 22100165
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0003674 Function Molecular_function ND
GO:0005575 Component Cellular_component ND
GO:0008150 Process Biological_process ND
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
300594 4098 ENSG00000205777
Protein
UniProt ID P0DTW1
Protein name G antigen 1 (GAGE-1) (Antigen MZ2-F) (Cancer/testis antigen 4.1) (CT4.1)
Protein function Antigen, recognized on melanoma by autologous cytolytic T-lymphocytes.
Family and domains
Tissue specificity TISSUE SPECIFICITY: Expressed in a variety of tumor tissues but not in normal tissues, except testis. {ECO:0000269|PubMed:7544395}.
Sequence
MSWRGRSTYYWPRPRRYVQPPEMIGPMRPEQFSDEVEPATPEEGEPATQRQDPAAAQEGE
DEGASAGQGPKPEADSQEQGHPQTGCECEDGPDGQEMDPPNPEEVKTPEEGEGQSQC
Sequence length 117
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Adenocarcinoma Adenocarcinoma, Adenocarcinoma, Basal Cell, Adenocarcinoma, Oxyphilic, Adenocarcinoma, Tubular rs121913530, rs886039394, rs121913474 14991579
Carcinoma Carcinoma, Cribriform, Carcinoma, Granular Cell rs121912654, rs555607708, rs786202962, rs1564055259 14991579
Pancreatic cancer Malignant neoplasm of pancreas rs118203998, rs180177143, rs587776417, rs587776527, rs864622498, rs876659571, rs587778587, rs886039619, rs745533713, rs1555460431 14991579
Unknown
Disease term Disease name Evidence References Source
Vitiligo Vitiligo GWAS
Asthma Asthma GWAS
Associations from Text Mining
Disease Name Relationship Type References
Ascites Associate 12115308
Carcinoma Hepatocellular Associate 10389981
Multiple Myeloma Associate 17312182
Neoplasms Associate 10389981, 12890744, 16929165, 17312182, 23138873, 9050879
Ovarian Neoplasms Associate 12115308, 20423514
Prostatic Neoplasms Associate 20053773, 26885621
Squamous Cell Carcinoma of Head and Neck Associate 16929165
Testicular Neoplasms Associate 17312182