Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	254263
Gene name Gene Name - the full gene name approved by the HGNC.	Cornichon family AMPA receptor auxiliary protein 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	CNIH2
Synonyms (NCBI Gene) Gene synonyms aliases	CNIH-2, Cnil
Chromosome Chromosome number	11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	11q13.2
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is an auxiliary subunit of the ionotropic glutamate receptor of the AMPA subtype. AMPA receptors mediate fast synaptic neurotransmission in the central nervous system. This protein has been reported to interact with the Ty

Show/Hide all(58)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017758	hsa-miR-335-5p	Microarray	18185580
MIRT899581	hsa-miR-3136-3p	CLIP-seq
MIRT899582	hsa-miR-4447	CLIP-seq
MIRT899583	hsa-miR-4472	CLIP-seq
MIRT899584	hsa-miR-4525	CLIP-seq
MIRT899585	hsa-miR-4651	CLIP-seq
MIRT899586	hsa-miR-4716-3p	CLIP-seq
MIRT899587	hsa-miR-4721	CLIP-seq
MIRT899588	hsa-miR-4723-5p	CLIP-seq
MIRT899589	hsa-miR-4728-5p	CLIP-seq
MIRT899590	hsa-miR-554	CLIP-seq
MIRT899591	hsa-miR-608	CLIP-seq
MIRT899592	hsa-miR-760	CLIP-seq
MIRT1966874	hsa-miR-1273	CLIP-seq
MIRT1966875	hsa-miR-1913	CLIP-seq
MIRT1966876	hsa-miR-324-3p	CLIP-seq
MIRT1966877	hsa-miR-342-5p	CLIP-seq
MIRT1966878	hsa-miR-3683	CLIP-seq
MIRT1966879	hsa-miR-376c	CLIP-seq
MIRT1966880	hsa-miR-4417	CLIP-seq
MIRT1966881	hsa-miR-4645-5p	CLIP-seq
MIRT1966882	hsa-miR-4664-5p	CLIP-seq
MIRT1966883	hsa-miR-4673	CLIP-seq
MIRT1966884	hsa-miR-4691-5p	CLIP-seq
MIRT1966885	hsa-miR-4719	CLIP-seq
MIRT899589	hsa-miR-4728-5p	CLIP-seq
MIRT1966886	hsa-miR-4743	CLIP-seq
MIRT1966887	hsa-miR-4761-5p	CLIP-seq
MIRT1966888	hsa-miR-541	CLIP-seq
MIRT1966889	hsa-miR-624	CLIP-seq
MIRT1966890	hsa-miR-654-5p	CLIP-seq
MIRT2202610	hsa-miR-1205	CLIP-seq
MIRT2202611	hsa-miR-1224-3p	CLIP-seq
MIRT2202612	hsa-miR-1266	CLIP-seq
MIRT2202613	hsa-miR-1275	CLIP-seq
MIRT2202614	hsa-miR-1279	CLIP-seq
MIRT2202615	hsa-miR-1909	CLIP-seq
MIRT1966877	hsa-miR-342-5p	CLIP-seq
MIRT2202616	hsa-miR-4446-3p	CLIP-seq
MIRT2202617	hsa-miR-4492	CLIP-seq
MIRT2202618	hsa-miR-4498	CLIP-seq
MIRT2202619	hsa-miR-4518	CLIP-seq
MIRT2202620	hsa-miR-4640-3p	CLIP-seq
MIRT1966881	hsa-miR-4645-5p	CLIP-seq
MIRT899585	hsa-miR-4651	CLIP-seq
MIRT1966882	hsa-miR-4664-5p	CLIP-seq
MIRT2202621	hsa-miR-4665-5p	CLIP-seq
MIRT1966883	hsa-miR-4673	CLIP-seq
MIRT1966884	hsa-miR-4691-5p	CLIP-seq
MIRT899586	hsa-miR-4716-3p	CLIP-seq
MIRT1966885	hsa-miR-4719	CLIP-seq
MIRT899588	hsa-miR-4723-5p	CLIP-seq
MIRT899589	hsa-miR-4728-5p	CLIP-seq
MIRT1966886	hsa-miR-4743	CLIP-seq
MIRT899591	hsa-miR-608	CLIP-seq
MIRT2202622	hsa-miR-637	CLIP-seq
MIRT2202623	hsa-miR-762	CLIP-seq
MIRT2202624	hsa-miR-939	CLIP-seq

Show/Hide all(26)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005102	Function	Signaling receptor binding	IBA
GO:0005515	Function	Protein binding	IPI	20805473, 32296183
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0005886	Component	Plasma membrane	IEA
GO:0012507	Component	ER to Golgi transport vesicle membrane	TAS
GO:0014069	Component	Postsynaptic density	IEA
GO:0014069	Component	Postsynaptic density	ISS
GO:0016020	Component	Membrane	IEA
GO:0016192	Process	Vesicle-mediated transport	IEA
GO:0030425	Component	Dendrite	IBA
GO:0030425	Component	Dendrite	IEA
GO:0030425	Component	Dendrite	ISS
GO:0032281	Component	AMPA glutamate receptor complex	ISS
GO:0033116	Component	Endoplasmic reticulum-Golgi intermediate compartment membrane	TAS
GO:0035249	Process	Synaptic transmission, glutamatergic	IBA
GO:0042995	Component	Cell projection	IEA
GO:0043197	Component	Dendritic spine	IEA
GO:0043197	Component	Dendritic spine	ISS
GO:0043198	Component	Dendritic shaft	ISS
GO:0045202	Component	Synapse	IBA
GO:0045202	Component	Synapse	IEA
GO:0045211	Component	Postsynaptic membrane	IEA
GO:0045211	Component	Postsynaptic membrane	ISS
GO:2000311	Process	Regulation of AMPA receptor activity	IDA	20805473

MIM	HGNC	e!Ensembl
611288	28744	ENSG00000174871

Protein

UniProt ID

Q6PI25

Protein name

Protein cornichon homolog 2 (CNIH-2) (Cornichon family AMPA receptor auxiliary protein 2) (Cornichon-like protein)

Protein function

Regulates the trafficking and gating properties of AMPA-selective glutamate receptors (AMPARs). Promotes their targeting to the cell membrane and synapses and modulates their gating properties by regulating their rates of activation, deactivatio

PDB

8SS2 , 8SS3 , 8SS4 , 8SS6 , 8SS7 , 8SSA , 8SSB

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF03311	Cornichon	7 → 49	Cornichon protein	Family
PF03311	Cornichon	50 → 151	Cornichon protein	Family

Tissue specificity

TISSUE SPECIFICITY: Expression is up-regulated in dorsolateral prefrontal cortex of patients with schizophrenia (postmortem brain study). {ECO:0000269|PubMed:23103966}.

Sequence

MAFTFAAFCYMLTLVLCASLIFFVIWHIIAFDELRTDFKNPIDQGNPARARERLKNIERI
CCLLRKLVVPEYSIHGLFCLMFLCAAEWVTLGLNIPLLFYHLWRYFHRPADGSEVMYDAV
SIMNADILNYCQKESWCKLAFYLLSFFYYLYSMVYTLVSF

Sequence length

160

Interactions

View interactions

	Reactome
			COPII-mediated vesicle transport Cargo concentration in the ER

Show/Hide Unknown Diseases (2)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Gout	Gout	N/A	N/A	GWAS
Insomnia	Insomnia	N/A	N/A	GWAS

Show/Hide Text Mining Associations (1)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Gout	Associate	25646370, 28642574

CNIH2 (cornichon family AMPA receptor auxiliary protein 2)