Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	254042
Gene name Gene Name - the full gene name approved by the HGNC.	Methionyl aminopeptidase type 1D, mitochondrial
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	METAP1D
Synonyms (NCBI Gene) Gene synonyms aliases	MAP 1D, MAP1D, MetAP 1D, Metap1l
Chromosome Chromosome number	2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	2q31.1
Summary Summary of gene provided in NCBI Entrez Gene.	The N-terminal methionine excision pathway is an essential process in which the N-terminal methionine is removed from many proteins, thus facilitating subsequent protein modification. In mitochondria, enzymes that catalyze this reaction are celled methion

Show/Hide all(44)

miRTarBase ID	miRNA	Experiments
MIRT1143584	hsa-miR-124	CLIP-seq
MIRT1143585	hsa-miR-4733-3p	CLIP-seq
MIRT1143586	hsa-miR-506	CLIP-seq
MIRT1143587	hsa-miR-548an	CLIP-seq
MIRT2390818	hsa-miR-4433	CLIP-seq
MIRT2390819	hsa-miR-4459	CLIP-seq
MIRT2390820	hsa-miR-4768-3p	CLIP-seq
MIRT2390821	hsa-miR-657	CLIP-seq
MIRT2453977	hsa-miR-1236	CLIP-seq
MIRT2453978	hsa-miR-1246	CLIP-seq
MIRT2453979	hsa-miR-1290	CLIP-seq
MIRT2453980	hsa-miR-132	CLIP-seq
MIRT2453981	hsa-miR-1537	CLIP-seq
MIRT2453982	hsa-miR-212	CLIP-seq
MIRT2453983	hsa-miR-216b	CLIP-seq
MIRT2453984	hsa-miR-3127-5p	CLIP-seq
MIRT2453985	hsa-miR-3145-5p	CLIP-seq
MIRT2453986	hsa-miR-3153	CLIP-seq
MIRT2453987	hsa-miR-3167	CLIP-seq
MIRT2453988	hsa-miR-3658	CLIP-seq
MIRT2453989	hsa-miR-3673	CLIP-seq
MIRT2453990	hsa-miR-3918	CLIP-seq
MIRT2453991	hsa-miR-4311	CLIP-seq
MIRT2453992	hsa-miR-432	CLIP-seq
MIRT2453993	hsa-miR-4666-3p	CLIP-seq
MIRT2453994	hsa-miR-4709-5p	CLIP-seq
MIRT2453995	hsa-miR-4753-3p	CLIP-seq
MIRT2453996	hsa-miR-508-5p	CLIP-seq
MIRT2453997	hsa-miR-876-5p	CLIP-seq
MIRT2453998	hsa-miR-942	CLIP-seq
MIRT2453978	hsa-miR-1246	CLIP-seq
MIRT2453979	hsa-miR-1290	CLIP-seq
MIRT2453985	hsa-miR-3145-5p	CLIP-seq
MIRT2453987	hsa-miR-3167	CLIP-seq
MIRT2453988	hsa-miR-3658	CLIP-seq
MIRT2453993	hsa-miR-4666-3p	CLIP-seq
MIRT2453996	hsa-miR-508-5p	CLIP-seq
MIRT2453997	hsa-miR-876-5p	CLIP-seq
MIRT2453978	hsa-miR-1246	CLIP-seq
MIRT2453979	hsa-miR-1290	CLIP-seq
MIRT2453987	hsa-miR-3167	CLIP-seq
MIRT2453988	hsa-miR-3658	CLIP-seq
MIRT2453993	hsa-miR-4666-3p	CLIP-seq
MIRT2453997	hsa-miR-876-5p	CLIP-seq

Show/Hide all(9)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004177	Function	Aminopeptidase activity	TAS	14532271
GO:0005739	Component	Mitochondrion	IDA	14532271
GO:0006508	Process	Proteolysis	IEA
GO:0008235	Function	Metalloexopeptidase activity	TAS	14532271
GO:0018206	Process	Peptidyl-methionine modification	TAS	14532271
GO:0031365	Process	N-terminal protein amino acid modification	TAS	14532271
GO:0046872	Function	Metal ion binding	IEA
GO:0070006	Function	Metalloaminopeptidase activity	IEA
GO:0070084	Process	Protein initiator methionine removal	IEA

MIM	HGNC	e!Ensembl
610267	32583	ENSG00000172878

Protein

UniProt ID

Q6UB28

Protein name

Methionine aminopeptidase 1D, mitochondrial (MAP 1D) (MetAP 1D) (EC 3.4.11.18) (Methionyl aminopeptidase type 1D, mitochondrial) (Peptidase M 1D)

Protein function

Removes the N-terminal methionine from nascent proteins. The N-terminal methionine is often cleaved when the second residue in the primary sequence is small and uncharged (Met-Ala-, Cys, Gly, Pro, Ser, Thr, or Val). Requires deformylation of the

PDB

8KHM , 8KHN , 8KHO

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00557	Peptidase_M24	95 → 322	Metallopeptidase family M24	Domain

Tissue specificity

TISSUE SPECIFICITY: Overexpressed in colon cancer cell lines and colon tumors as compared to normal tissues (at protein level). {ECO:0000269|PubMed:16568094}.

Sequence

MAAPSGVHLLVRRGSHRIFSSPLNHIYLHKQSSSQQRRNFFFRRQRDISHSIVLPAAVSS
AHPVPKHIKKPDYVTTGIVPDWGDSIEVKNEDQIQGLHQACQLARHVLLLAGKSLKVDMT
TEEIDALVHREIISHNAYPSPLGYGGFPKSVCTSVNNVLCHGIPDSRPLQDGDIINIDVT
VYYNGYHGDTSETFLVGNVDECGKKLVEVARRCRDEAIAACRAGAPFSVIGNTISHITHQ
NGFQVCPHFVGHGIGSYFHGHPEIWHHANDSDLPMEEGMAFTIEPIITEGSPEFKVLEDA
WTVVSLDNQRSAQFEHTVLITSRGAQILTKLPHEA

Sequence length

335

Interactions

View interactions

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Leukemia	Leukemia, Myelocytic, Acute	rs121909646, rs121913488, rs587776834, rs752746786, rs869312821, rs767454740, rs1554564297	27903959

Show/Hide Unknown Diseases (3)

Disease term	Disease name	Source
Unknown
Metabolic Syndrome	Metabolic Syndrome	GWAS
Insomnia	Insomnia	GWAS
Schizophrenia	Schizophrenia	GWAS

Show/Hide Text Mining Associations (3)

Disease Name	Relationship Type	References
Associations from Text Mining
Colorectal Neoplasms	Stimulate	23815882
Neoplasms	Stimulate	23815882
Optic Atrophy Hereditary Leber	Associate	36233195

METAP1D (methionyl aminopeptidase type 1D, mitochondrial)