Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
2538
Gene name Gene Name - the full gene name approved by the HGNC.
Glucose-6-phosphatase catalytic subunit 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
G6PC1
Synonyms (NCBI Gene) Gene synonyms aliases
G6PC, G6PT, G6Pase, GSD1, GSD1a
Chromosome Chromosome number
17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
17q21.31
Summary Summary of gene provided in NCBI Entrez Gene.
Glucose-6-phosphatase (G6Pase) is a multi-subunit integral membrane protein of the endoplasmic reticulum that is composed of a catalytic subunit and transporters for G6P, inorganic phosphate, and glucose. This gene (G6PC) is one of the three glucose-6-pho
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs1801175 C>T Pathogenic Coding sequence variant, missense variant
rs1801176 G>A Pathogenic Coding sequence variant, missense variant
rs80356479 C>- Pathogenic Frameshift variant, coding sequence variant
rs80356482 G>A,C Pathogenic Missense variant, coding sequence variant
rs80356483 G>T Pathogenic-likely-pathogenic Missense variant, coding sequence variant, 3 prime UTR variant
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0004346 Function Glucose-6-phosphatase activity EXP 12093795
GO:0004346 Function Glucose-6-phosphatase activity IBA
GO:0004346 Function Glucose-6-phosphatase activity IDA 8211187, 10318794, 15661744
GO:0004346 Function Glucose-6-phosphatase activity IEA
GO:0004346 Function Glucose-6-phosphatase activity TAS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
613742 4056 ENSG00000131482
Protein
UniProt ID P35575
Protein name Glucose-6-phosphatase catalytic subunit 1 (EC 3.1.3.9) (Glucose-6-phosphatase) (G-6-Pase) (G6Pase) (Glucose-6-phosphatase alpha) (G6Pase-alpha)
Protein function Hydrolyzes glucose-6-phosphate to glucose in the endoplasmic reticulum. Forms with the glucose-6-phosphate transporter (SLC37A4/G6PT) the complex responsible for glucose production in the terminal step of glycogenolysis and gluconeogenesis. Henc
PDB 9J7U , 9J7V
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01569 PAP2 57 204 PAP2 superfamily Family
Sequence
MEEGMNVLHDFGIQSTHYLQVNYQDSQDWFILVSVIADLRNAFYVLFPIWFHLQEAVGIK
LLWVAVIGDWLNLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHA
MGTAGVYYVMVTSTLSIFQGKIKPTYRFRCLNVILWLGFWAVQLNVCLSRIYLAAHFPHQ
VVAGVLSGIAVAETFSHIHSIYNA
SLKKYFLITFFLFSFAIGFYLLLKGLGVDLLWTLEK
AQRWCEQPEWVHIDTTPFASLLKNLGTLFGLGLALNSSMYRESCKGKLSKWLPFRLSSIV
ASLVLLHVFDSLKPPSQVELVFYVLSFCKSAVVPLASVSVIPYCLAQVLGQPHKKSL
Sequence length 357
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
FoxO signaling pathway
PI3K-Akt signaling pathway
AMPK signaling pathway
Insulin signaling pathway
Adipocytokine signaling pathway
Glucagon signaling pathway
Insulin resistance
Carbohydrate digestion and absorption
  Glycogen storage disease type Ia (G6PC)
Gluconeogenesis
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Glycogen Storage Disease glycogen storage disease due to glucose-6-phosphatase deficiency type ia, Glycogen storage disease, type I rs780226142, rs1597989983, rs2056091436, rs80356486, rs1801175, rs80356482, rs1555560140, rs1597990895, rs367727229, rs766448695, rs1555560204, rs104894563, rs1801176, rs1555560185, rs1597990906
View all (49 more)
N/A