WDR27 (WD repeat domain 27)

Gene
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
253769
Gene name Gene Name - the full gene name approved by the HGNC.
WD repeat domain 27
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
WDR27
Synonyms (NCBI Gene) Gene synonyms aliases
-
Chromosome Chromosome number
6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
6q27
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a protein with multiple WD repeats. Proteins with these repeats may form scaffolds for protein-protein interaction and play key roles in cell signalling. Alternative splicing results in multiple transcript variants, but the full-length s
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(5)
miRTarBase ID miRNA Experiments Reference
MIRT1490015 hsa-miR-4659a-3p CLIP-seq
MIRT1490016 hsa-miR-4659b-3p CLIP-seq
MIRT1490017 hsa-miR-4753-3p CLIP-seq
MIRT1490018 hsa-miR-4768-5p CLIP-seq
MIRT1490019 hsa-miR-618 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(2)
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 25416956
GO:0005654 Component Nucleoplasm IDA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
620936 21248 ENSG00000184465
Protein
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID A2RRH5
Protein name WD repeat-containing protein 27
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00400 WD40 154 → 193 WD domain, G-beta repeat Repeat
PF00400 WD40 507 → 541 WD domain, G-beta repeat Repeat
PF00400 WD40 547 → 583 WD domain, G-beta repeat Repeat
PF00400 WD40 743 → 783 WD domain, G-beta repeat Repeat
PF00400 WD40 787 → 824 WD domain, G-beta repeat Repeat
Sequence 
MENPQDIFSSNGGCLSDIVIEKYLVESKESVSHVQLACSMQDCAFPLDGTELCIWNTKDP
SHQLLILRGHHQPITAMAFGNKVNPLLICSASLDYVIMWNLDECREKVLQGLVPRGTVMG
SLLGKVLCLQLSLDDHVVAVCAGNKIFMLDIETQAVRAELQGHLGPVTAVEFCPWRAGTL
ISASEDRGFKVWDHCTGSLIYSSSVLSAYPLLSLFIDAESRQLVTGCADGQLWIFSLMDG
HHYRRVARVDLRKKTETFSTRRVKSGLCSQPEESQLPSTSALGKGEQVEVTFPVLRLAPC
DLSLIPNSACGCLSSENTRCVWIGSSVGLFVFNLANLEVEAALYYKDFQSLSILLAGSCA
LRNRTADQKVLCLLASLFGGKIAVLEINPAALVRAQQCPSMGQSLSVPASSCVLPTSPLY
LGIAKEKSTKAASEQRRAARNVMKDQRLVFHSKVRSSGYASAPHVTMFSPKTNIKSEGKG
SSRSRSSCAREAYPVECAVPTKPGPQVAAAPTCTRVCCIQYSGDGQWLACGLANHLLLVF
DASLTGTPAVFSGHDGAVNAVCWSQDRRWLLSAARDGTLRMWSARGAELALLLGKDMFSK
PIQSAQFYYIDAFILLSSGPEFQLLRYHIDTCKDEIKRYKQKSKSKLICRLSTTGAVDMT
SLSAVNDFYSHIVLAAGRNRTVEVFDLNAGCSAAVIAEAHSRPVHQICQNKGSSFTTQQP
QAYNLFLTTAIGDGMRLWDLRTLRCERHFEGHPTRGYPCGIAFSPCGRFAACGAEDRHAY
VYEMGSSTFSHRLAGHTDTVTGVAFNPSAPQLATATLDGKLQLFLAE
Sequence length 827
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Unknown Diseases (2)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Endometriosis Endometriosis N/A N/A GWAS
Insomnia Insomnia, Insomnia complaints N/A N/A GWAS
Show/Hide Text Mining Associations (5)
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Arthritis Rheumatoid Associate 26776603
Disorders of Excessive Somnolence Associate 27992416
Heart Diseases Associate 33428857
Plaque Amyloid Associate 33428857
Sleep Initiation and Maintenance Disorders Associate 27992416