Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
253738
Gene name Gene Name - the full gene name approved by the HGNC.
EBF transcription factor 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
EBF3
Synonyms (NCBI Gene) Gene synonyms aliases
COE3, EBF-3, HADDS, O/E-2, OE-2
Chromosome Chromosome number
10
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
10q26.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the early B-cell factor (EBF) family of DNA binding transcription factors. EBF proteins are involved in B-cell differentiation, bone development and neurogenesis, and may also function as tumor suppressors. The encoded protei
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs778076484 G>C,T Pathogenic Stop gained, coding sequence variant, genic upstream transcript variant, non coding transcript variant, missense variant
rs779003155 G>A,T Pathogenic Synonymous variant, non coding transcript variant, coding sequence variant, missense variant
rs869312668 G>A Pathogenic Non coding transcript variant, coding sequence variant, missense variant, genic upstream transcript variant
rs886040976 T>C Likely-pathogenic Non coding transcript variant, coding sequence variant, missense variant
rs1057519389 C>A,G,T Likely-pathogenic, pathogenic Genic upstream transcript variant, non coding transcript variant, missense variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT951373 hsa-miR-1283 CLIP-seq
MIRT951374 hsa-miR-197 CLIP-seq
MIRT951375 hsa-miR-299-3p CLIP-seq
MIRT951376 hsa-miR-30a CLIP-seq
MIRT951377 hsa-miR-30b CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific ISA
GO:0003677 Function DNA binding IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
607407 19087 ENSG00000108001
Protein
UniProt ID Q9H4W6
Protein name Transcription factor COE3 (Early B-cell factor 3) (EBF-3) (Olf-1/EBF-like 2) (O/E-2) (OE-2)
Protein function Transcriptional activator (PubMed:28017370, PubMed:28017372, PubMed:28017373). Recognizes variations of the palindromic sequence 5'-ATTCCCNNGGGAATT-3' (By similarity). {ECO:0000250|UniProtKB:Q07802, ECO:0000269|PubMed:28017370, ECO:0000269|PubMe
PDB 3MUJ , 3N50
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF16422 COE1_DBD 17 247 Transcription factor COE1 DNA-binding domain Domain
PF01833 TIG 263 345 IPT/TIG domain Domain
PF16423 COE1_HLH 348 391 Transcription factor COE1 helix-loop-helix domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in brain. {ECO:0000269|PubMed:12355068}.
Sequence
MFGIQENIPRGGTTMKEEPLGSGMNPVRSWMHTAGVVDANTAAQSGVGLARAHFEKQPPS
NLRKSNFFHFVLALYDRQGQPVEIERTAFVDFVEKEKEPNNEKTNNGIHYKLQLLYSNGV
RTEQDLYVRLIDSMTKQAIVYEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDP
VIIDRFFLKFFLKCNQNCLKNAGNPRDMRRFQVVVSTTVNVDGHVLAVSDNMFVHNNSKH
GRRARRL
DPSEGTAPSYLENATPCIKAISPSEGWTTGGATVIIIGDNFFDGLQVVFGTML
VWSELITPHAIRVQTPPRHIPGVVEVTLSYKSKQFCKGAPGRFVY
TALNEPTIDYGFQRL
QKVIPRHPGDPERLPKEVLLKRAADLVEALY
GMPHNNQEIILKRAADIAEALYSVPRNHN
QIPTLGNNPAHTGMMGVNSFSSQLAVNVSETSQANDQVGYSRNTSSVSPRGYVPSSTPQQ
SNYNTVSTSMNGYGSGAMASLGVPGSPGFLNGSSANSPYGIVPSSPTMAASSVTLPSNCS
STHGIFSFSPANVISAVKQKSAFAPVVRPQASPPPSCTSANGNGLQAMSGLVVPPM
Sequence length 596
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Hypotonia, Ataxia, And Delayed Development Syndrome hypotonia, ataxia, and delayed development syndrome rs1057519520, rs1589745620, rs1057519521, rs1589767274, rs1057519522, rs1589962586, rs797046136, rs1064794961, rs869312668, rs1064796669, rs1057519389, rs1131692261, rs1131692258, rs1057519437, rs1554904330
View all (6 more)
N/A
Pierre-Robin Syndrome Isolated Pierre-Robin syndrome rs1057519389 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Dementia Dementia N/A N/A GWAS
Erectile Dysfunction Erectile dysfunction N/A N/A GWAS
Insomnia Insomnia N/A N/A GWAS
Restless Legs Syndrome Restless legs syndrome N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Alcohol Related Disorders Associate 28017372
Arthritis Rheumatoid Associate 23456299
Ataxia Associate 28017372, 28017373, 28487885, 29162653, 34999443
Autistic Disorder Associate 29162653, 34256850
Bicornuate Uterus Associate 28487885
Central Nervous System Vascular Malformations Associate 28017372
Cerebellar Ataxia Associate 28017370
Cognition Disorders Associate 34999443
Colorectal Neoplasms Associate 31383000
Delayed Cranial Ossification due to CBFB Haploinsufficiency Associate 29162653