Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
2537
Gene name Gene Name - the full gene name approved by the HGNC.
Interferon alpha inducible protein 6
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
IFI6
Synonyms (NCBI Gene) Gene synonyms aliases
6-16, FAM14C, G1P3, IFI-6-16, IFI616
Chromosome Chromosome number
1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
1p35.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene was first identified as one of the many genes induced by interferon. The encoded protein may play a critical role in the regulation of apoptosis. A minisatellite that consists of 26 repeats of a 12 nucleotide repeating element resembling the mam
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT019676 hsa-miR-375 Microarray 20215506
MIRT054332 hsa-miR-1225-3p Microarray, qRT-PCR 23593351
MIRT1060280 hsa-miR-1285 CLIP-seq
MIRT1060281 hsa-miR-1299 CLIP-seq
MIRT1060282 hsa-miR-1469 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001836 Process Release of cytochrome c from mitochondria IMP 15685448
GO:0005515 Function Protein binding IPI 15685448
GO:0005739 Component Mitochondrion IBA 21873635
GO:0005739 Component Mitochondrion IDA 15685448, 25757571
GO:0005743 Component Mitochondrial inner membrane IDA 29899394
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
147572 4054 ENSG00000126709
Protein
UniProt ID P09912
Protein name Interferon alpha-inducible protein 6 (Interferon-induced protein 6-16) (Ifi-6-16)
Protein function Interferon-stimulated protein that plays an important role in innate immune response against a wide variety of viruses (PubMed:31142663). Inhibits flavivirus replication by preventing the formation of virus-induced endoplasmic reticulum membrane
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF06140 Ifi-6-16 41 119 Interferon-induced 6-16 family Family
Sequence
MRQKAVSLFLCYLLLFTCSGVEAGKKKCSESSDSGSGFWKALTFMAVGGGLAVAGLPALG
FTGAGIAANSVAASLMSWSAILNGGGVPAGGLVATLQSLGAGGSSVVIGNIGALMGYAT
H
KYLDSEEDEE
Sequence length 130
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Interferon alpha/beta signaling
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Unknown
Disease term Disease name Evidence References Source
Mental depression Major Depressive Disorder 29175309 ClinVar
Associations from Text Mining
Disease Name Relationship Type References
Alzheimer Disease Associate 15685448
Asthma Associate 23148572
Breast Neoplasms Associate 12841681, 29899394, 34055036, 35075167, 36766731
Breast Neoplasms Inhibit 35301803
Carcinogenesis Associate 24098334
Colorectal Neoplasms Associate 36596524
COVID 19 Associate 33138195, 34730223, 36072597, 36333264, 36507688, 36911695, 38162574
Dermatitis Allergic Contact Associate 35028126
Dermatomyositis Associate 35609018, 35711463, 37353938
Desmoid disease hereditary Associate 33444924