Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
253559
Gene name Gene Name - the full gene name approved by the HGNC.
Cell adhesion molecule 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CADM2
Synonyms (NCBI Gene) Gene synonyms aliases
IGSF4D, NECL3, Necl-3, SynCAM 2, SynCAM-2, synCAM2
Chromosome Chromosome number
3
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
3p12.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the synaptic cell adhesion molecule 1 (SynCAM) family which belongs to the immunoglobulin (Ig) superfamily. The encoded protein has three Ig-like domains and a cytosolic protein 4.1 binding site near the C-terminus. Proteins
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT053422 hsa-miR-624-3p Microarray 23807165
MIRT624473 hsa-miR-3606-3p HITS-CLIP 23824327
MIRT624472 hsa-miR-513a-3p HITS-CLIP 23824327
MIRT624471 hsa-miR-513c-3p HITS-CLIP 23824327
MIRT624470 hsa-miR-7110-3p HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005886 Component Plasma membrane TAS
GO:0007155 Process Cell adhesion IEA
GO:0016021 Component Integral component of membrane IEA
GO:0030424 Component Axon IEA
GO:0034332 Process Adherens junction organization TAS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
609938 29849 ENSG00000175161
Protein
UniProt ID Q8N3J6
Protein name Cell adhesion molecule 2 (Immunoglobulin superfamily member 4D) (IgSF4D) (Nectin-like protein 3) (NECL-3) (Synaptic cell adhesion molecule 2) (SynCAM 2)
Protein function Adhesion molecule that engages in homo- and heterophilic interactions with the other nectin-like family members, leading to cell aggregation. Important for synapse organization, providing regulated trans-synaptic adhesion. Preferentially binds t
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07686 V-set 28 121 Immunoglobulin V-set domain Domain
PF08205 C2-set_2 126 213 CD80-like C2-set immunoglobulin domain Domain
PF13927 Ig_3 226 300 Domain
Sequence
MIWKRSAVLRFYSVCGLLLQGSQGQFPLTQNVTVVEGGTAILTCRVDQNDNTSLQWSNPA
QQTLYFDDKKALRDNRIELVRASWHELSISVSDVSLSDEGQYTCSLFTMPVKTSKAYLTV
L
GVPEKPQISGFSSPVMEGDLMQLTCKTSGSKPAADIRWFKNDKEIKDVKYLKEEDANRK
TFTVSSTLDFRVDRSDDGVAVICRVDHESLNAT
PQVAMQVLEIHYTPSVKIIPSTPFPQE
GQPLILTCESKGKPLPEPVLWTKDGGELPDPDRMVVSGRELNILFLNKTDNGTYRCEATN

TIGQSSAEYVLIVHDVPNTLLPTTIIPSLTTATVTTTVAITTSPTTSATTSSIRDPNALA
GQNGPDHALIGGIVAVVVFVTLCSIFLLGRYLARHKGTYLTNEAKGAEDAPDADTAIINA
EGSQVNAEEKKEYFI
Sequence length 435
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Adherens junctions interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Glaucoma Glaucoma, Glaucoma, Open-Angle rs121918355, rs1566660365, rs1566635134, rs121918356, rs1566634475, rs28936700, rs55771538, rs28936701, rs104893622, rs55989760, rs72549387, rs104893628, rs2125316417, rs104893629, rs74315328
View all (29 more)
30104761, 30054594, 29891935
Leukemia Leukemia, Myelocytic, Acute rs121909646, rs121913488, rs587776834, rs752746786, rs869312821, rs767454740, rs1554564297 27903959
Obesity Obesity rs74315349, rs1474810899, rs121918111, rs796065034, rs753856820, rs796065035, rs121918112, rs104894023, rs137852821, rs1580764441, rs137852822, rs137852823, rs137852824, rs13447324, rs121913562
View all (27 more)
23563607
Schizophrenia Schizophrenia rs13447324, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346
View all (12 more)
31374203
Unknown
Disease term Disease name Evidence References Source
Neuroticism Neuroticism GWAS
Bipolar Disorder Bipolar Disorder GWAS
Metabolic Syndrome Metabolic Syndrome GWAS
Gout Gout GWAS
Associations from Text Mining
Disease Name Relationship Type References
Alzheimer Disease Associate 27046643, 29899525
Anxiety Disorders Associate 34741163
Attention Deficit Disorder with Hyperactivity Associate 36774336, 38335780
Autism Spectrum Disorder Associate 21996756
Autistic Disorder Associate 28973307, 36150388
Bipolar Disorder Associate 33168801
Carcinogenesis Associate 37228062
Carcinoma Hepatocellular Inhibit 29506532
Carcinoma Hepatocellular Associate 37228062, 38126999
Carcinoma Renal Cell Associate 34222474