Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
253017
Gene name Gene Name - the full gene name approved by the HGNC.
Trans-2,3-enoyl-CoA reductase like
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
TECRL
Synonyms (NCBI Gene) Gene synonyms aliases
CPVT3, GPSN2L, SRD5A2L2, TERL
Disease Acronyms (UniProt) Disease acronyms from UniProt database
CPVT3
Chromosome Chromosome number
4
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
4q13.1
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene contains a ubiquitin-like domain in the N-terminal region, three transmembrane segments and a C-terminal 3-oxo-5-alpha steroid 4-dehydrogenase domain. The protein belongs to the steroid 5-alpha reductase family. Mutations
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs773204795 C>T Pathogenic, likely-pathogenic Coding sequence variant, non coding transcript variant, missense variant
rs958406908 T>C,G Pathogenic Intron variant, genic downstream transcript variant
rs1057517699 C>T Pathogenic Splice donor variant, intron variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT515773 hsa-miR-8485 HITS-CLIP 21572407
MIRT515774 hsa-miR-329-3p HITS-CLIP 21572407
MIRT515772 hsa-miR-362-3p HITS-CLIP 21572407
MIRT515771 hsa-miR-603 HITS-CLIP 21572407
MIRT515769 hsa-miR-4789-3p HITS-CLIP 21572407
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005783 Component Endoplasmic reticulum IDA 27861123
GO:0016021 Component Integral component of membrane IEA
GO:0016491 Function Oxidoreductase activity IBA 21873635
GO:0016627 Function Oxidoreductase activity, acting on the CH-CH group of donors IEA
GO:0042761 Process Very long-chain fatty acid biosynthetic process IBA 21873635
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
617242 27365 ENSG00000205678
Protein
UniProt ID Q5HYJ1
Protein name Trans-2,3-enoyl-CoA reductase-like (EC 1.3.1.-) (Steroid 5-alpha-reductase 2-like 2 protein)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02544 Steroid_dh 210 363 3-oxo-5-alpha-steroid 4-dehydrogenase Family
Tissue specificity TISSUE SPECIFICITY: Predominantly expressed in the heart and skeletal muscle. {ECO:0000269|PubMed:27861123}.
Sequence
MFKRHKSLASERKRALLSQRATRFILKDDMRNFHFLSKLVLSAGPLRPTPAVKHSKTTHF
EIEIFDAQTRKQICILDKVTQSSTIHDVKQKFHKACPKWYPSRVGLQLECGGPFLKDYIT
IQSIAASSIVTLYATDLGQQVSWTTVFLAEYTGPLLIYLLFYLRIPCIYDGKESARRLRH
PVVHLACFCHCIHYIRYLLETLFVHKVSAGHTPLKNLIMSCAFYWGFTSWIAYYINHPLY
TPPSFGNRQITVSAINFLICEAGNHFINVMLSHPNHTGNNACFPSPNYNPFTWMFFLVSC
PNYTYEIGSWISFTVMTQTLPVGIFTLLMSIQMSLWAQKKHKIYLRKFNSYIHRKSAMIP
FIL
Sequence length 363
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Synthesis of very long-chain fatty acyl-CoAs
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Catecholaminergic polymorphic ventricular tachycardia VENTRICULAR TACHYCARDIA, CATECHOLAMINERGIC POLYMORPHIC, 1 (disorder), Catecholaminergic polymorphic ventricular tachycardia rs121918597, rs121918598, rs121918599, rs121918600, rs121918601, rs121918602, rs121918603, rs121918604, rs121918605, rs121434549, rs786205106, rs121434550, rs267607276, rs267607277, rs397507555
View all (105 more)
27861123
Long qt syndrome Long QT Syndrome rs121434386, rs120074177, rs104894252, rs120074181, rs120074182, rs120074178, rs120074179, rs120074180, rs12720459, rs120074183, rs120074184, rs120074185, rs120074186, rs17215500, rs120074188
View all (552 more)
Ventricular tachycardia Tachycardia, Ventricular, Familial ventricular tachycardia, VENTRICULAR TACHYCARDIA, CATECHOLAMINERGIC POLYMORPHIC, 3 rs137853228, rs397517025, rs199473373, rs727504432, rs1450434935, rs1592847299 27861123
Unknown
Disease term Disease name Evidence References Source
Catecholaminergic Polymorphic Ventricular Tachycardia catecholaminergic polymorphic ventricular tachycardia 3, catecholaminergic polymorphic ventricular tachycardia GenCC
Psoriasis Psoriasis GWAS
Associations from Text Mining
Disease Name Relationship Type References
Arrhythmias Cardiac Associate 27861123, 33367594
Death Sudden Associate 33367594
Death Sudden Cardiac Associate 27784710, 27861123
Heart Arrest Associate 27861123
Long QT Syndrome Associate 27861123, 33367594
Polymorphic catecholergic ventricular tachycardia Associate 27861123, 33367594, 34557911, 35679758
Tachycardia Ventricular Associate 27861123
Urinary Bladder Neoplasms Associate 38071230