FUT7 (fucosyltransferase 7)

Gene

• Entrez ID: 2529
• Gene name: Fucosyltransferase 7
• Gene symbol: FUT7
• Synonyms (NCBI Gene): FucT-VII
• Chromosome: 9
• Chromosome location: 9q34.3
• Summary: The protein encoded by this gene is a Golgi stack membrane protein that is involved in the creation of sialyl-Lewis X antigens. The encoded protein can direct the synthesis of the E-selectin-binding sialyl-Lewis X moiety. [provided by RefSeq, Jul 2008]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT035912	hsa-miR-1180-3p	CLASH	23622248
MIRT1006780	hsa-miR-1245b-3p	CLIP-seq
MIRT1006781	hsa-miR-320e	CLIP-seq
MIRT1006782	hsa-miR-4330	CLIP-seq
MIRT1998287	hsa-miR-214	CLIP-seq
MIRT1006781	hsa-miR-320e	CLIP-seq
MIRT1998288	hsa-miR-3619-5p	CLIP-seq
MIRT1998289	hsa-miR-3620	CLIP-seq
MIRT1998290	hsa-miR-4269	CLIP-seq
MIRT1998291	hsa-miR-4690-5p	CLIP-seq
MIRT1998292	hsa-miR-5096	CLIP-seq
MIRT1998293	hsa-miR-761	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
GATA3	Unknown	17075044
TBX21	Unknown	17075044

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001807	Process	Regulation of type IV hypersensitivity	ISS
GO:0002361	Process	CD4-positive, CD25-positive, alpha-beta regulatory T cell differentiation	IEA
GO:0002522	Process	Leukocyte migration involved in immune response	IEA
GO:0002523	Process	Leukocyte migration involved in inflammatory response	ISS
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005794	Component	Golgi apparatus	IDA
GO:0005794	Component	Golgi apparatus	TAS	11698403
GO:0005802	Component	Trans-Golgi network	IDA	23192350
GO:0006486	Process	Protein glycosylation	IDA	11404359
GO:0006486	Process	Protein glycosylation	IEA
GO:0006486	Process	Protein glycosylation	TAS	11698403
GO:0006672	Process	Ceramide metabolic process	IDA	9299472
GO:0006954	Process	Inflammatory response	ISS
GO:0007566	Process	Embryo implantation	IMP	18402946
GO:0008417	Function	Fucosyltransferase activity	IDA	9299472, 11404359
GO:0016020	Component	Membrane	HDA	19946888
GO:0016021	Component	Integral component of membrane	IEA
GO:0017083	Function	4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase activity	IDA	9473504
GO:0022407	Process	Regulation of cell-cell adhesion	IMP	10200296
GO:0022409	Process	Positive regulation of cell-cell adhesion	IMP	18553500
GO:0032580	Component	Golgi cisterna membrane	IEA
GO:0036065	Process	Fucosylation	IBA	21873635
GO:0042355	Process	L-fucose catabolic process	NAS	11698403
GO:0045785	Process	Positive regulation of cell adhesion	IMP	10386892
GO:0046626	Process	Regulation of insulin receptor signaling pathway	IMP	17229154
GO:0046920	Function	Alpha-(1->3)-fucosyltransferase activity	IBA	21873635
GO:0046920	Function	Alpha-(1->3)-fucosyltransferase activity	IDA	8207002, 9299472, 9405391, 9461592, 11278338
GO:0046920	Function	Alpha-(1->3)-fucosyltransferase activity	IMP	15926890, 23192350
GO:0046920	Function	Alpha-(1->3)-fucosyltransferase activity	TAS	11698403
GO:0060353	Process	Regulation of cell adhesion molecule production	IMP	8666674
GO:0097021	Process	Lymphocyte migration into lymphoid organs	IEA
GO:1903037	Process	Regulation of leukocyte cell-cell adhesion	IMP	23192350
GO:1903236	Process	Regulation of leukocyte tethering or rolling	IMP	23192350
GO:1903238	Process	Positive regulation of leukocyte tethering or rolling	ISS
GO:1904996	Process	Positive regulation of leukocyte adhesion to vascular endothelial cell	IMP	29138114
GO:2000389	Process	Regulation of neutrophil extravasation	IEA

Other IDs

• MIM: 602030
• HGNC: 4018
• e!Ensembl: ENSG00000180549

Protein

• UniProt ID: Q11130
• Protein name: Alpha-(1,3)-fucosyltransferase 7 (EC 2.4.1.-) (Fucosyltransferase 7) (Fucosyltransferase VII) (Fuc-TVII) (FucT-VII) (Galactoside 3-L-fucosyltransferase) (Selectin ligand synthase)
• Protein function: Catalyzes the transfer of L-fucose, from a guanosine diphosphate-beta-L-fucose, to the N-acetyl glucosamine (GlcNAc) of a distal alpha2,3 sialylated lactosamine unit of a glycoprotein or a glycolipid-linked sialopolylactosamines chain through an
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF17039	Glyco_tran_10_N	44 → 154	Fucosyltransferase, N-terminal	Domain
  PF00852	Glyco_transf_10	169 → 340	Glycosyltransferase family 10 (fucosyltransferase) C-term	Family

• Tissue specificity: TISSUE SPECIFICITY: Leukocytic/myeloid lineage cells.
• Sequence:

  MNNAGHGPTRRLRGLGVLAGVALLAALWLLWLLGSAPRGTPAPQPTITILVWHWPFTDQP
  PELPSDTCTRYGIARCHLSANRSLLASADAVVFHHRELQTRRSHLPLAQRPRGQPWVWAS
  MESPSHTHGLSHLRGIFNWVLSYRRDSDIFVPYGRLEPHWGPSPPLPAKSRVAAWVVSNF
  QERQLRARLYRQLAPHLRVDVFGRANGRPLCASCLVPTVAQYRFYLSFENSQHRDYITEK
  FWRNALVAGTVPVVLGPPRATYEAFVPADAFVHVDDFGSARELAAFLTGMNESRYQRFFA
  WRDRLRVRLFTDWRERFCAICDRYPHLPRSQVYEDLEGWFQA

• Sequence length: 342

Pathways

KEGG:

Glycosphingolipid biosynthesis - lacto and neolacto series
Metabolic pathways

Reactome:

Lewis blood group biosynthesis

Associated diseases

Unknown
Disease term	Disease name	Evidence	References	Source
Myocardial infarction	Myocardial Infarction		21211798	ClinVar

Associations from Text Mining
Disease Name	Relationship Type	References
Calcinosis Cutis	Associate	1544942
Calcinosis Cutis	Stimulate	19889975
Carcinoma Non Small Cell Lung	Associate	31793656
Carcinoma Renal Cell	Associate	35955933
Carcinoma Squamous Cell	Associate	36463240
Endometrial Neoplasms	Associate	7775258
Hypoxia Brain	Stimulate	15141079
Leukemia Lymphoma Adult T Cell	Associate	12506041
Lung Neoplasms	Associate	36463240
Lymphoma B Cell	Associate	35784355
Neoplasms	Associate	15141079, 34134578, 35955933
Neoplasms	Stimulate	31793656
Prostatic Neoplasms	Stimulate	19889975
Triple Negative Breast Neoplasms	Associate	34134578