Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	252884
Gene name	Zinc finger protein 396
Gene symbol	ZNF396
Synonyms (NCBI Gene)	ZSCAN14
Chromosome	18
Chromosome location	18q12.2

Show/Hide all (49)

miRTarBase ID	miRNA	Experiments	Reference
MIRT497740	hsa-miR-602	PAR-CLIP	22291592
MIRT497739	hsa-miR-4681	PAR-CLIP	22291592
MIRT497738	hsa-miR-3145-3p	PAR-CLIP	22291592
MIRT497740	hsa-miR-602	PAR-CLIP	22291592
MIRT497739	hsa-miR-4681	PAR-CLIP	22291592
MIRT497738	hsa-miR-3145-3p	PAR-CLIP	22291592
MIRT1523835	hsa-miR-1183	CLIP-seq
MIRT1523836	hsa-miR-203	CLIP-seq
MIRT1523837	hsa-miR-29a	CLIP-seq
MIRT1523838	hsa-miR-29b	CLIP-seq
MIRT1523839	hsa-miR-29c	CLIP-seq
MIRT1523840	hsa-miR-3121-3p	CLIP-seq
MIRT1523841	hsa-miR-3137	CLIP-seq
MIRT1523842	hsa-miR-3148	CLIP-seq
MIRT1523843	hsa-miR-3149	CLIP-seq
MIRT1523844	hsa-miR-3688-3p	CLIP-seq
MIRT1523845	hsa-miR-3915	CLIP-seq
MIRT1523846	hsa-miR-3928	CLIP-seq
MIRT1523847	hsa-miR-4307	CLIP-seq
MIRT1523848	hsa-miR-4775	CLIP-seq
MIRT1523849	hsa-miR-568	CLIP-seq
MIRT1523850	hsa-miR-570	CLIP-seq
MIRT1523851	hsa-miR-577	CLIP-seq
MIRT1523852	hsa-miR-590-3p	CLIP-seq
MIRT1523853	hsa-miR-767-5p	CLIP-seq
MIRT1523843	hsa-miR-3149	CLIP-seq
MIRT2158336	hsa-miR-4502	CLIP-seq
MIRT2158337	hsa-miR-4762-3p	CLIP-seq
MIRT1523848	hsa-miR-4775	CLIP-seq
MIRT1523849	hsa-miR-568	CLIP-seq
MIRT1523852	hsa-miR-590-3p	CLIP-seq
MIRT2377804	hsa-miR-1236	CLIP-seq
MIRT2377805	hsa-miR-1914	CLIP-seq
MIRT2377806	hsa-miR-214	CLIP-seq
MIRT2377807	hsa-miR-3074-5p	CLIP-seq
MIRT2377808	hsa-miR-3124-3p	CLIP-seq
MIRT2377809	hsa-miR-3190	CLIP-seq
MIRT2377810	hsa-miR-3619-5p	CLIP-seq
MIRT2377811	hsa-miR-4261	CLIP-seq
MIRT2377812	hsa-miR-4291	CLIP-seq
MIRT2377813	hsa-miR-4760-3p	CLIP-seq
MIRT2377814	hsa-miR-761	CLIP-seq
MIRT2377815	hsa-miR-888	CLIP-seq
MIRT2377816	hsa-miR-922	CLIP-seq
MIRT2377817	hsa-miR-935	CLIP-seq
MIRT2377818	hsa-miR-944	CLIP-seq
MIRT2397547	hsa-miR-155	CLIP-seq
MIRT1523848	hsa-miR-4775	CLIP-seq
MIRT1523852	hsa-miR-590-3p	CLIP-seq

Show/Hide all (19)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0003677	Function	DNA binding	IEA
GO:0005515	Function	Protein binding	IPI	28514442, 32296183
GO:0005634	Component	Nucleus	IDA	12801647
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IDA	12801647
GO:0005737	Component	Cytoplasm	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0008270	Function	Zinc ion binding	IEA
GO:0042803	Function	Protein homodimerization activity	IPI	12801647
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IDA	12801647
GO:0045892	Process	Negative regulation of DNA-templated transcription	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0046982	Function	Protein heterodimerization activity	IPI	12801647
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

MIM	HGNC	e!Ensembl
609600	18824	ENSG00000186496

Q96N95

Protein name

Zinc finger protein 396 (Zinc finger and SCAN domain-containing protein 14)

Protein function

Isoform 1 and isoform 2 act as DNA-dependent transcriptional repressors.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02023	SCAN	48 → 137	SCAN domain	Domain
PF00096	zf-C2H2	251 → 273	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	307 → 329	Zinc finger, C2H2 type	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed strongly in liver, moderately in skeletal muscle and weakly in kidney, pancreas, spleen and prostate. {ECO:0000269|PubMed:12801647}.

Sequence

MSAKLGKSSSLLTQTSEECNGILTEKMEEEEQTCDPDSSLHWSSSYSPETFRQQFRQFGY
QDSPGPHEALSRLWELCHLWLRPEVHTKEQILELLVLEQFLAILPKELQAWVQKHHPENG
EETVTMLEDVERELDGPKQIFFGRRKDMIAEKLAPSEITEELPSSQLMPVKKQLQGASWE
LQSLRPHDEDIKTTNVKSASRQKTSLGIELHCNVSNILHMNGSQSSTYRGTYEQDGRFEK
RQGNPSWKKQQKCDECGKIFSQSSALILHQRIHSGKKPYACDECAKAFSRSAILIQHRRT
HTGEKPYKCHDCGKAFSQSSNLFRHRKRHIRKKVP

Sequence length

335

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
COLOR VISION DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IRRITABLE BOWEL SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (1)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Thymoma	Associate	30816514	★★★★★ ★☆☆☆☆ Found in Text Mining only

ZNF396 (zinc finger protein 396)