FUT5 (fucosyltransferase 5)

Gene

• Entrez ID: 2527
• Gene name: Fucosyltransferase 5
• Gene symbol: FUT5
• Synonyms (NCBI Gene): FUC-TV
• Chromosome: 19
• Chromosome location: 19p13.3

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1006738	hsa-miR-3120-3p	CLIP-seq
MIRT1006739	hsa-miR-3130-3p	CLIP-seq
MIRT1006740	hsa-miR-3942-5p	CLIP-seq
MIRT1006741	hsa-miR-4703-5p	CLIP-seq
MIRT1006742	hsa-miR-548aa	CLIP-seq
MIRT1006743	hsa-miR-596	CLIP-seq
MIRT1006744	hsa-miR-767-5p	CLIP-seq
MIRT1006745	hsa-miR-876-3p	CLIP-seq
MIRT2388256	hsa-miR-1909	CLIP-seq
MIRT2388257	hsa-miR-214	CLIP-seq
MIRT2388258	hsa-miR-2355-5p	CLIP-seq
MIRT2388259	hsa-miR-2467-5p	CLIP-seq
MIRT2388260	hsa-miR-3619-5p	CLIP-seq
MIRT2388261	hsa-miR-4530	CLIP-seq
MIRT2388262	hsa-miR-761	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	IEA
GO:0000139	Component	Golgi membrane	TAS
GO:0005794	Component	Golgi apparatus	IEA
GO:0005794	Component	Golgi apparatus	TAS	11698403
GO:0005975	Process	Carbohydrate metabolic process	TAS	1339443
GO:0006486	Process	Protein glycosylation	IEA
GO:0006486	Process	Protein glycosylation	TAS	11698403
GO:0006487	Process	Protein N-linked glycosylation	IDA	29593094
GO:0006493	Process	Protein O-linked glycosylation	IDA	29593094
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006665	Process	Sphingolipid metabolic process	IEA
GO:0006672	Process	Ceramide metabolic process	IDA	7721776, 9737988, 17604274
GO:0008417	Function	Fucosyltransferase activity	IDA	7721776, 17604274
GO:0008417	Function	Fucosyltransferase activity	IEA
GO:0008417	Function	Fucosyltransferase activity	TAS	1339443
GO:0009311	Process	Oligosaccharide metabolic process	IDA	1740457, 9737988
GO:0009312	Process	Oligosaccharide biosynthetic process	IEA
GO:0009312	Process	Oligosaccharide biosynthetic process	TAS
GO:0016020	Component	Membrane	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0016757	Function	Glycosyltransferase activity	IEA
GO:0017060	Function	3-galactosyl-N-acetylglucosaminide 4-alpha-L-fucosyltransferase activity	IDA	1740457, 9737988, 14718375
GO:0017060	Function	3-galactosyl-N-acetylglucosaminide 4-alpha-L-fucosyltransferase activity	IEA
GO:0017083	Function	4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase activity	IDA	1740457, 7721776, 9737988, 14718375, 17604274, 29593094
GO:0017083	Function	4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase activity	IEA
GO:0032580	Component	Golgi cisterna membrane	IEA
GO:0036065	Process	Fucosylation	IBA
GO:0042355	Process	L-fucose catabolic process	NAS	11698403
GO:0046920	Function	Alpha-(1->3)-fucosyltransferase activity	IBA
GO:0046920	Function	Alpha-(1->3)-fucosyltransferase activity	TAS	11698403

Other IDs

• MIM: 136835
• HGNC: 4016
• e!Ensembl: ENSG00000130383

Protein

• UniProt ID: Q11128
• Protein name: 4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase FUT5 (EC 2.4.1.152) (3-galactosyl-N-acetylglucosaminide 4-alpha-L-fucosyltransferase FUT5) (EC 2.4.1.65) (Fucosyltransferase 5) (Fucosyltransferase V) (Fuc-TV) (FucT-V) (Galactoside 3-L-fucos
• Protein function: Catalyzes preferentially the transfer of L-fucose, from a guanosine diphosphate-beta-L-fucose, to the N-acetyl-beta-D-glucosamine (GlcNAc) of an N-acetyllactosamine unit (type 2 chain) of an oligosaccharide, or a glycoprotein- and a glycolipid-l
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF17039	Glyco_tran_10_N	73 → 183	Fucosyltransferase, N-terminal	Domain
  PF00852	Glyco_transf_10	202 → 373	Glycosyltransferase family 10 (fucosyltransferase) C-term	Family

• Tissue specificity: TISSUE SPECIFICITY: Liver, colon and testis and trace amounts in T-cells and brain.
• Sequence:

  MDPLGPAKPQWLWRRCLAGLLFQLLVAVCFFSYLRVSRDDATGSPRPGLMAVEPVTGAPN
  GSRCQDSMATPAHPTLLILLWTWPFNTPVALPRCSEMVPGAADCNITADSSVYPQADAVI
  VHHWDIMYNPSANLPPPTRPQGQRWIWFSMESPSNCRHLEALDGYFNLTMSYRSDSDIFT
  PYGWLEPWSGQPAHPPLNLSAKTELVAWAVSNWKPDSARVRYYQSLQAHLKVDVYGRSHK
  PLPKGTMMETLSRYKFYLAFENSLHPDYITEKLWRNALEAWAVPVVLGPSRSNYERFLPP
  DAFIHVDDFQSPKDLARYLQELDKDHARYLSYFRWRETLRPRSFSWALAFCKACWKLQQE
  SRYQTVRSIAAWFT

• Sequence length: 374

Pathways

KEGG:

Glycosphingolipid biosynthesis - lacto and neolacto series
Metabolic pathways

Reactome:

Lewis blood group biosynthesis

<