GAST (gastrin)

Gene Gene information from NCBI Gene database.
Gene Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID 2520
Gene name Gastrin
Gene symbol GAST
Synonyms (NCBI Gene)
GAS
Chromosome 17
Chromosome location 17q21.2
Summary Gastrin is a hormone whose main function is to stimulate secretion of hydrochloric acid by the gastric mucosa, which results in gastrin formation inhibition. This hormone also acts as a mitogenic factor for gastrointestinal epithelial cells. Gastrin has t
Transcription factors Transcription factors information provided by TRRUST V2 database.
10
Gene Transcription factors Gene ontology Other IDs Protein Pathways
Show/Hide all (10)
Transcription factor Regulation Reference
JUND Activation 21852362
MEN1 Repression 21852362
SP1 Activation 15613302
SP1 Unknown 2566164
STAT1 Activation 20568281
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
11
Gene Transcription factors Gene ontology Other IDs Protein Pathways
Show/Hide all (11)
GO ID Ontology Definition Evidence Reference
GO:0005179 Function Hormone activity IBA
GO:0005179 Function Hormone activity IEA
GO:0005179 Function Hormone activity TAS 7488110
GO:0005515 Function Protein binding IPI 7681836, 19664057, 32296183
GO:0005576 Component Extracellular region IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene Transcription factors Gene ontology Other IDs Protein Pathways
MIM HGNC e!Ensembl
137250 4164 ENSG00000184502
Protein Protein information from UniProt database.
Gene Transcription factors Gene ontology Other IDs Protein Pathways
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P01350
Protein name Gastrin [Cleaved into: Gastrin-71 (Gastrin component I); Gastrin-52 (G52); Big gastrin (Gastrin component II) (Gastrin-34) (G34); Gastrin (Gastrin component III) (Gastrin-17) (G17); Gastrin-14 (G14); Gastrin-6 (G6)]
Protein function Gastrin stimulates the stomach mucosa to produce and secrete hydrochloric acid and the pancreas to secrete its digestive enzymes. It also stimulates smooth muscle contraction and increases blood circulation and water secretion in the stomach and
PDB 5WRJ , 7F8V , 7F8W , 7XOW
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00918 Gastrin 72 → 101 Gastrin/cholecystokinin family Family
Sequence 
MQRLCVYVLIFALALAAFSEASWKPRSQQPDAPLGTGANRDLELPWLEQQGPASHHRRQL
GPQGPPHLVADPSKKQGPWLEEEEEAYGWMDFGRRSAEDEN
Sequence length 101
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene Transcription factors Gene ontology Other IDs Protein Pathways
  KEGG  Reactome
  Hormone signaling
Gastric acid secretion 		  G alpha (q) signalling events
Gastrin-CREB signalling pathway via PKC and MAPK