GAST (gastrin)

Gene
Gene Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
2520
Gene name Gene Name - the full gene name approved by the HGNC.
Gastrin
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
GAST
Synonyms (NCBI Gene) Gene synonyms aliases
GAS
Chromosome Chromosome number
17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
17q21.2
Summary Summary of gene provided in NCBI Entrez Gene.
Gastrin is a hormone whose main function is to stimulate secretion of hydrochloric acid by the gastric mucosa, which results in gastrin formation inhibition. This hormone also acts as a mitogenic factor for gastrointestinal epithelial cells. Gastrin has t
Transcription factors
Gene Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(10)
Transcription factor Regulation Reference
JUND Activation 21852362
MEN1 Repression 21852362
SP1 Activation 15613302
SP1 Unknown 2566164
STAT1 Activation 20568281
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(11)
GO ID Ontology Definition Evidence Reference
GO:0005179 Function Hormone activity IBA
GO:0005179 Function Hormone activity IEA
GO:0005179 Function Hormone activity TAS 7488110
GO:0005515 Function Protein binding IPI 7681836, 19664057, 32296183
GO:0005576 Component Extracellular region IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
137250 4164 ENSG00000184502
Protein
Gene Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID P01350
Protein name Gastrin [Cleaved into: Gastrin-71 (Gastrin component I); Gastrin-52 (G52); Big gastrin (Gastrin component II) (Gastrin-34) (G34); Gastrin (Gastrin component III) (Gastrin-17) (G17); Gastrin-14 (G14); Gastrin-6 (G6)]
Protein function Gastrin stimulates the stomach mucosa to produce and secrete hydrochloric acid and the pancreas to secrete its digestive enzymes. It also stimulates smooth muscle contraction and increases blood circulation and water secretion in the stomach and
PDB 5WRJ , 7F8V , 7F8W , 7XOW
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00918 Gastrin 72 → 101 Gastrin/cholecystokinin family Family
Sequence 
MQRLCVYVLIFALALAAFSEASWKPRSQQPDAPLGTGANRDLELPWLEQQGPASHHRRQL
GPQGPPHLVADPSKKQGPWLEEEEEAYGWMDFGRRSAEDEN
Sequence length 101
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG   Reactome
  Hormone signaling
Gastric acid secretion 		  G alpha (q) signalling events
Gastrin-CREB signalling pathway via PKC and MAPK
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Gene Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Unknown Diseases (2)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Breast Cancer BRCA1 mutation in breast cancer N/A N/A GWAS
Duodenal Ulcer Duodenal ulcer N/A N/A GWAS
Show/Hide Text Mining Associations (75)
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Achlorhydria Stimulate 18326692
Adenocarcinoma Associate 11076881, 24086717, 24416123
Adenoma Associate 29544460
Barrett Esophagus Stimulate 18438722
Barrett Esophagus Associate 33782049
Biliary Tract Neoplasms Associate 15682471
Bone Diseases Associate 29158412
Breast Neoplasms Associate 21288332
Carcinogenesis Associate 15492468, 15929170, 21274374, 25752269, 30510283
Carcinogenesis Inhibit 32142681