ALPP (alkaline phosphatase, placental)

Gene

• Entrez ID: 250
• Gene name: Alkaline phosphatase, placental
• Gene symbol: ALPP
• Synonyms (NCBI Gene): ALP, ALPI, IAP, PALP, PLAP, PLAP-1
• Chromosome: 2
• Chromosome location: 2q37.1
• Summary: The protein encoded by this gene is an alkaline phosphatase, a metalloenzyme that catalyzes the hydrolysis of phosphoric acid monoesters. It belongs to a multigene family composed of four alkaline phosphatase isoenzymes. The enzyme functions as a homodime

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT779126	hsa-miR-1193	CLIP-seq
MIRT779127	hsa-miR-1207-5p	CLIP-seq
MIRT779128	hsa-miR-1224-3p	CLIP-seq
MIRT779129	hsa-miR-136	CLIP-seq
MIRT779130	hsa-miR-148a	CLIP-seq
MIRT779131	hsa-miR-148b	CLIP-seq
MIRT779132	hsa-miR-152	CLIP-seq
MIRT779133	hsa-miR-1976	CLIP-seq
MIRT779134	hsa-miR-2392	CLIP-seq
MIRT779135	hsa-miR-3152-3p	CLIP-seq
MIRT779136	hsa-miR-3936	CLIP-seq
MIRT779137	hsa-miR-4271	CLIP-seq
MIRT779138	hsa-miR-4454	CLIP-seq
MIRT779139	hsa-miR-4662a-5p	CLIP-seq
MIRT779140	hsa-miR-4676-5p	CLIP-seq
MIRT779141	hsa-miR-4725-3p	CLIP-seq
MIRT779142	hsa-miR-4728-5p	CLIP-seq
MIRT779143	hsa-miR-4736	CLIP-seq
MIRT779144	hsa-miR-4747-5p	CLIP-seq
MIRT779145	hsa-miR-4763-3p	CLIP-seq
MIRT779146	hsa-miR-4795-3p	CLIP-seq
MIRT779147	hsa-miR-5096	CLIP-seq
MIRT779148	hsa-miR-575	CLIP-seq
MIRT1545323	hsa-miR-4292	CLIP-seq
MIRT779126	hsa-miR-1193	CLIP-seq
MIRT779128	hsa-miR-1224-3p	CLIP-seq
MIRT779129	hsa-miR-136	CLIP-seq
MIRT779130	hsa-miR-148a	CLIP-seq
MIRT779131	hsa-miR-148b	CLIP-seq
MIRT779132	hsa-miR-152	CLIP-seq
MIRT779133	hsa-miR-1976	CLIP-seq
MIRT779134	hsa-miR-2392	CLIP-seq
MIRT779135	hsa-miR-3152-3p	CLIP-seq
MIRT1930003	hsa-miR-3622b-5p	CLIP-seq
MIRT779138	hsa-miR-4454	CLIP-seq
MIRT779139	hsa-miR-4662a-5p	CLIP-seq
MIRT779140	hsa-miR-4676-5p	CLIP-seq
MIRT779142	hsa-miR-4728-5p	CLIP-seq
MIRT779147	hsa-miR-5096	CLIP-seq
MIRT779148	hsa-miR-575	CLIP-seq
MIRT1930004	hsa-miR-637	CLIP-seq
MIRT2170743	hsa-miR-106a	CLIP-seq
MIRT2170744	hsa-miR-106b	CLIP-seq
MIRT779126	hsa-miR-1193	CLIP-seq
MIRT779128	hsa-miR-1224-3p	CLIP-seq
MIRT2170745	hsa-miR-1234	CLIP-seq
MIRT779129	hsa-miR-136	CLIP-seq
MIRT779130	hsa-miR-148a	CLIP-seq
MIRT779131	hsa-miR-148b	CLIP-seq
MIRT2170746	hsa-miR-150	CLIP-seq
MIRT779132	hsa-miR-152	CLIP-seq
MIRT2170747	hsa-miR-17	CLIP-seq
MIRT2170748	hsa-miR-188-3p	CLIP-seq
MIRT779133	hsa-miR-1976	CLIP-seq
MIRT2170749	hsa-miR-20a	CLIP-seq
MIRT2170750	hsa-miR-20b	CLIP-seq
MIRT779134	hsa-miR-2392	CLIP-seq
MIRT2170751	hsa-miR-302a	CLIP-seq
MIRT2170752	hsa-miR-302b	CLIP-seq
MIRT2170753	hsa-miR-302c	CLIP-seq
MIRT2170754	hsa-miR-302d	CLIP-seq
MIRT2170755	hsa-miR-302e	CLIP-seq
MIRT779135	hsa-miR-3152-3p	CLIP-seq
MIRT1930003	hsa-miR-3622b-5p	CLIP-seq
MIRT2170756	hsa-miR-372	CLIP-seq
MIRT2170757	hsa-miR-373	CLIP-seq
MIRT2170758	hsa-miR-3977	CLIP-seq
MIRT779138	hsa-miR-4454	CLIP-seq
MIRT779139	hsa-miR-4662a-5p	CLIP-seq
MIRT779140	hsa-miR-4676-5p	CLIP-seq
MIRT2170759	hsa-miR-4731-5p	CLIP-seq
MIRT2170760	hsa-miR-512-3p	CLIP-seq
MIRT2170761	hsa-miR-519d	CLIP-seq
MIRT2170762	hsa-miR-520a-3p	CLIP-seq
MIRT2170763	hsa-miR-520b	CLIP-seq
MIRT2170764	hsa-miR-520c-3p	CLIP-seq
MIRT2170765	hsa-miR-520d-3p	CLIP-seq
MIRT2170766	hsa-miR-520d-5p	CLIP-seq
MIRT2170767	hsa-miR-520e	CLIP-seq
MIRT2170768	hsa-miR-520g	CLIP-seq
MIRT2170769	hsa-miR-520h	CLIP-seq
MIRT2170770	hsa-miR-524-5p	CLIP-seq
MIRT2170771	hsa-miR-539	CLIP-seq
MIRT2170772	hsa-miR-552	CLIP-seq
MIRT779148	hsa-miR-575	CLIP-seq
MIRT2170773	hsa-miR-580	CLIP-seq
MIRT2170774	hsa-miR-93	CLIP-seq
MIRT2443586	hsa-miR-1827	CLIP-seq
MIRT2443587	hsa-miR-2467-3p	CLIP-seq
MIRT2443588	hsa-miR-3121-5p	CLIP-seq
MIRT2443589	hsa-miR-4659a-5p	CLIP-seq
MIRT2443590	hsa-miR-4659b-5p	CLIP-seq
MIRT2443591	hsa-miR-4776-3p	CLIP-seq
MIRT2443592	hsa-miR-720	CLIP-seq
MIRT2443586	hsa-miR-1827	CLIP-seq
MIRT779130	hsa-miR-148a	CLIP-seq
MIRT779131	hsa-miR-148b	CLIP-seq
MIRT779132	hsa-miR-152	CLIP-seq
MIRT2443586	hsa-miR-1827	CLIP-seq
MIRT2473439	hsa-miR-3679-3p	CLIP-seq
MIRT2473440	hsa-miR-4446-5p	CLIP-seq
MIRT2443592	hsa-miR-720	CLIP-seq
MIRT2473439	hsa-miR-3679-3p	CLIP-seq
MIRT2473440	hsa-miR-4446-5p	CLIP-seq
MIRT2443592	hsa-miR-720	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000287	Function	Magnesium ion binding	ISS
GO:0004035	Function	Alkaline phosphatase activity	IBA
GO:0004035	Function	Alkaline phosphatase activity	IDA	1939159, 2017684, 2133555
GO:0004035	Function	Alkaline phosphatase activity	IEA
GO:0004035	Function	Alkaline phosphatase activity	NAS	3042787
GO:0005515	Function	Protein binding	IPI	25416956, 32296183
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	IEA
GO:0008270	Function	Zinc ion binding	ISS
GO:0009986	Component	Cell surface	IDA	15907827
GO:0016020	Component	Membrane	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0016791	Function	Phosphatase activity	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0098552	Component	Side of membrane	IEA

Other IDs

• MIM: 171800
• HGNC: 439
• e!Ensembl: ENSG00000163283

Protein

• UniProt ID: P05187
• Protein name: Alkaline phosphatase, placental type (EC 3.1.3.1) (Alkaline phosphatase Regan isozyme) (Placental alkaline phosphatase 1) (PLAP-1)
• Protein function: Alkaline phosphatase that can hydrolyze various phosphate compounds.
• PDB: 1EW2, 1ZEB, 1ZED, 1ZEF, 2GLQ, 3MK0, 3MK1, 3MK2
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00245	Alk_phosphatase	55 → 490	Alkaline phosphatase	Domain

• Tissue specificity: TISSUE SPECIFICITY: Detected in placenta (at protein level). {ECO:0000269|PubMed:20693656}.
• Sequence:

  MLGPCMLLLLLLLGLRLQLSLGIIPVEEENPDFWNREAAEALGAAKKLQPAQTAAKNLII
  FLGDGMGVSTVTAARILKGQKKDKLGPEIPLAMDRFPYVALSKTYNVDKHVPDSGATATA
  YLCGVKGNFQTIGLSAAARFNQCNTTRGNEVISVMNRAKKAGKSVGVVTTTRVQHASPAG
  TYAHTVNRNWYSDADVPASARQEGCQDIATQLISNMDIDVILGGGRKYMFRMGTPDPEYP
  DDYSQGGTRLDGKNLVQEWLAKRQGARYVWNRTELMQASLDPSVTHLMGLFEPGDMKYEI
  HRDSTLDPSLMEMTEAALRLLSRNPRGFFLFVEGGRIDHGHHESRAYRALTETIMFDDAI
  ERAGQLTSEEDTLSLVTADHSHVFSFGGYPLRGSSIFGLAPGKARDRKAYTVLLYGNGPG
  YVLKDGARPDVTESESGSPEYRQQSAVPLDEETHAGEDVAVFARGPQAHLVHGVQEQTFI
  AHVMAFAACLEPYTACDLAPPAGTTDAAHPGRSVVPALLPLLAGTLLLLETATAP

• Sequence length: 535

Pathways

KEGG:

Thiamine metabolism
Folate biosynthesis
Metabolic pathways
Biosynthesis of cofactors

Reactome:

Intra-Golgi traffic

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALKALINE PHOSPHATASE, PLACENTAL, ALLELE-1 POLYMORPHISM	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ALKALINE PHOSPHATASE, PLACENTAL, ALLELE-3 POLYMORPHISM	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial pancreatic carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Relationship Type	References	Evidence Score
Acidemia isovaleric	Associate	20723612	★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Associate	34363325	★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of Lung	Associate	34363325	★☆☆☆☆ Found in Text Mining only
Adrenal Hyperplasia Congenital	Associate	19352053	★☆☆☆☆ Found in Text Mining only
Anemia Aplastic	Stimulate	9883800	★☆☆☆☆ Found in Text Mining only
Anemia Sickle Cell	Associate	35855023	★☆☆☆☆ Found in Text Mining only
Aortic Valve Stenosis	Associate	35951069	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Stimulate	37662902	★☆☆☆☆ Found in Text Mining only
Asthma	Associate	30737985	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Associate	29973151	★☆☆☆☆ Found in Text Mining only
Bone Diseases	Associate	35941659	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Associate	27150055, 27334837, 30679450, 34224831, 7945240	★☆☆☆☆ Found in Text Mining only
Calcinosis	Associate	16505034, 17591888, 20723612, 27353274, 27495942, 30679450, 35951069	★☆☆☆☆ Found in Text Mining only
Calcinosis Cutis	Associate	35049690	★☆☆☆☆ Found in Text Mining only
Carcinoma Embryonal	Stimulate	34363325	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Associate	25152598, 29776350, 31628070, 40323083	★☆☆☆☆ Found in Text Mining only
Carcinoma Non Small Cell Lung	Associate	34518802	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Associate	31391026	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Associate	16081252	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Hypertrophic	Associate	20723612, 22796508	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Associate	31568963	★☆☆☆☆ Found in Text Mining only
Chemical and Drug Induced Liver Injury	Associate	31088856, 31628070, 34274980	★☆☆☆☆ Found in Text Mining only
Chemical and Drug Induced Liver Injury	Stimulate	37839783	★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Associate	34363325	★☆☆☆☆ Found in Text Mining only
Cholangitis Sclerosing	Associate	30730351	★☆☆☆☆ Found in Text Mining only
Cholestasis	Associate	31628070	★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Associate	2745460	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Associate	25037223, 32453965, 34363325	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Stimulate	33507690	★☆☆☆☆ Found in Text Mining only
Congenital adrenal hyperplasia due to 21 hydroxylase deficiency	Associate	19352053	★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Associate	36669962	★☆☆☆☆ Found in Text Mining only
Death	Associate	11547844, 31391026, 31568963	★☆☆☆☆ Found in Text Mining only
Dentin dysplasia type 1	Associate	32737282	★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Associate	17077152	★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Associate	24417746	★☆☆☆☆ Found in Text Mining only
Developmental Dysplasia of the Hip	Associate	33413534	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Stimulate	24566377, 27353274	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Inhibit	26400360	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Associate	31088856	★☆☆☆☆ Found in Text Mining only
Digestive System Diseases	Associate	38234425	★☆☆☆☆ Found in Text Mining only
Endodermal Sinus Tumor	Stimulate	34363325	★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Associate	34363325, 7515261	★☆☆☆☆ Found in Text Mining only
Epilepsy	Associate	11547844	★☆☆☆☆ Found in Text Mining only
Femoral Fractures	Associate	35229197	★☆☆☆☆ Found in Text Mining only
Femoral Fractures Distal	Associate	35229197	★☆☆☆☆ Found in Text Mining only
Foot Deformities	Associate	35229197	★☆☆☆☆ Found in Text Mining only
Gastroschisis	Associate	31075877, 32163230	★☆☆☆☆ Found in Text Mining only
Glaucoma	Stimulate	17591888	★☆☆☆☆ Found in Text Mining only
Growth Disorders	Associate	32772198	★☆☆☆☆ Found in Text Mining only
Hand Foot and Mouth Disease	Stimulate	27706779	★☆☆☆☆ Found in Text Mining only
Heart Diseases	Associate	26577411	★☆☆☆☆ Found in Text Mining only
Hemoglobinuria Paroxysmal	Associate	16867159	★☆☆☆☆ Found in Text Mining only
Hemoglobinuria Paroxysmal	Inhibit	9883800	★☆☆☆☆ Found in Text Mining only
Hemolysis	Associate	20118060	★☆☆☆☆ Found in Text Mining only
Hepatitis B	Associate	35765099	★☆☆☆☆ Found in Text Mining only
Hypercalcemia	Associate	26783040	★☆☆☆☆ Found in Text Mining only
Hyperostosis corticalis deformans juvenilis	Associate	17181397, 23322328, 32298837	★☆☆☆☆ Found in Text Mining only
Hypertrophy	Associate	32790806	★☆☆☆☆ Found in Text Mining only
Hypophosphatasia	Associate	11547844, 22014174, 2220817, 22703652, 24022022, 25396326, 25736332, 2705456, 29724887, 31787692, 31793067, 33827627, 33844893, 34711245, 34854399, 35229197, 35878747, 36820543, 37107680, 37839783, 38234425, 38307176, 677124	★☆☆☆☆ Found in Text Mining only
Hypophosphatasia	Inhibit	19335222, 22322541, 24123110, 26783040, 30764793, 32066479, 32772198	★☆☆☆☆ Found in Text Mining only
Hypophosphatasia Adult	Associate	31267001, 35498405	★☆☆☆☆ Found in Text Mining only
Hypoxia	Inhibit	25889814	★☆☆☆☆ Found in Text Mining only
Inclusion Body Myopathy With Early Onset Paget Disease And Frontotemporal Dementia	Associate	18260132	★☆☆☆☆ Found in Text Mining only
Inflammation	Associate	29566379, 35951069	★☆☆☆☆ Found in Text Mining only
Inflammation	Inhibit	32597574	★☆☆☆☆ Found in Text Mining only
Inflammation	Stimulate	34502489	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Associate	30730351	★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Associate	18940312	★☆☆☆☆ Found in Text Mining only
Invasive Pulmonary Aspergillosis	Associate	9058095	★☆☆☆☆ Found in Text Mining only
Leukemia	Associate	27732563	★☆☆☆☆ Found in Text Mining only
Leukocyte adhesion deficiency type 1	Associate	36139135	★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Alcoholic	Associate	34033144	★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Biliary	Associate	30709684	★☆☆☆☆ Found in Text Mining only
Liver Diseases	Stimulate	37839783	★☆☆☆☆ Found in Text Mining only
Liver Failure	Associate	31141540, 31628070	★☆☆☆☆ Found in Text Mining only
Lung Diseases	Associate	9058095	★☆☆☆☆ Found in Text Mining only
Lymphoma	Associate	27732563	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Microvillus inclusion disease	Inhibit	16081252	★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Associate	30197328	★☆☆☆☆ Found in Text Mining only
Muscle Weakness	Associate	31787692	★☆☆☆☆ Found in Text Mining only
Muscular Diseases	Associate	18260132	★☆☆☆☆ Found in Text Mining only
Musculoskeletal Diseases	Associate	31787692	★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Associate	31568963	★☆☆☆☆ Found in Text Mining only
Myositis Inclusion Body	Associate	17077152	★☆☆☆☆ Found in Text Mining only
Neonatal onset citrullinemia type 2	Associate	23067347	★☆☆☆☆ Found in Text Mining only
Neoplasm Metastasis	Associate	22333159, 30568232, 34363325	★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	11124260, 2444242, 26242403, 30197328, 30915882, 31666285, 34363325, 3548400, 6711565, 8297725	★☆☆☆☆ Found in Text Mining only
Neoplasms Cystic Mucinous and Serous	Stimulate	3548400	★☆☆☆☆ Found in Text Mining only
Neoplasms Germ Cell and Embryonal	Associate	1697556, 2745460, 8297725	★☆☆☆☆ Found in Text Mining only
No Reflow Phenomenon	Associate	29973151	★☆☆☆☆ Found in Text Mining only
Nonseminomatous germ cell tumor	Associate	1697556	★☆☆☆☆ Found in Text Mining only
Obesity	Associate	24094242	★☆☆☆☆ Found in Text Mining only
Ossification Heterotopic	Associate	36803548	★☆☆☆☆ Found in Text Mining only
Ossification of Posterior Longitudinal Ligament	Associate	21442291, 24097291	★☆☆☆☆ Found in Text Mining only
Osteitis Deformans	Associate	32176830	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Stimulate	19215023	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Associate	20723612, 34502489	★☆☆☆☆ Found in Text Mining only
Osteogenesis Imperfecta	Associate	31486477	★☆☆☆☆ Found in Text Mining only
Osteoporosis	Associate	31486477, 31858576, 32016954, 35188450, 35650135, 37662902	★☆☆☆☆ Found in Text Mining only
Osteoporotic Fractures	Associate	35941659	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Associate	22333159, 25396326, 26960368, 39768988	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Stimulate	33797312	★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Associate	26242403	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Associate	24280306, 27802199, 34363325, 3548400, 36139135, 3906119	★☆☆☆☆ Found in Text Mining only
Overweight	Associate	24094242	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Associate	31391026	★☆☆☆☆ Found in Text Mining only
Polycystic liver disease	Associate	37750370	★☆☆☆☆ Found in Text Mining only
Polymyositis	Associate	17077152	★☆☆☆☆ Found in Text Mining only
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Inhibit	34039781	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Associate	30568232	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Stimulate	33507690	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Associate	39223457	★☆☆☆☆ Found in Text Mining only
Recombinant chromosome 8 syndrome	Associate	30293905	★☆☆☆☆ Found in Text Mining only
Renal Insufficiency Chronic	Associate	29566379, 32722241	★☆☆☆☆ Found in Text Mining only
Seminoma	Associate	1697556, 2781220	★☆☆☆☆ Found in Text Mining only
Seminoma	Stimulate	34363325	★☆☆☆☆ Found in Text Mining only
Soft Tissue Injuries	Associate	17591888	★☆☆☆☆ Found in Text Mining only
Spondylitis Ankylosing	Associate	36803548	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Associate	31366234	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Associate	17172820, 34363325	★☆☆☆☆ Found in Text Mining only
Testicular Germ Cell Tumor	Associate	34363325	★☆☆☆☆ Found in Text Mining only
Tooth Loss	Associate	26783040	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Associate	36139135	★☆☆☆☆ Found in Text Mining only
Vaginosis Bacterial	Associate	11547844	★☆☆☆☆ Found in Text Mining only
Vascular Calcification	Associate	23518467, 24441913, 29566379, 29973151, 32722241	★☆☆☆☆ Found in Text Mining only
Waardenburg Syndrome	Associate	1349198	★☆☆☆☆ Found in Text Mining only
Xeroderma pigmentosum variant type	Associate	40141433	★☆☆☆☆ Found in Text Mining only