Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	2494
Gene name	Nuclear receptor subfamily 5 group A member 2
Gene symbol	NR5A2
Synonyms (NCBI Gene)	B1FB1F2CPFFTFFTZ-F1FTZ-F1betaLRH-1LRH1hB1F-2
Chromosome	1
Chromosome location	1q32.1
Summary	The protein encoded by this gene is a DNA-binding zinc finger transcription factor and is a member of the fushi tarazu factor-1 subfamily of orphan nuclear receptors. The encoded protein is involved in the expression of genes for hepatitis B virus and cho

166

Show/Hide all (166)

miRTarBase ID	miRNA	Experiments	Reference
MIRT023720	hsa-miR-1-3p	Microarray	18668037
MIRT054410	hsa-miR-139-5p	Luciferase reporter assayqRT-PCRWestern blot	24204738
MIRT446057	hsa-miR-548aa	PAR-CLIP	22100165
MIRT446056	hsa-miR-548ap-3p	PAR-CLIP	22100165
MIRT446055	hsa-miR-548t-3p	PAR-CLIP	22100165
MIRT446054	hsa-miR-570-3p	PAR-CLIP	22100165
MIRT446053	hsa-miR-653-5p	PAR-CLIP	22100165
MIRT446057	hsa-miR-548aa	PAR-CLIP	22100165
MIRT446056	hsa-miR-548ap-3p	PAR-CLIP	22100165
MIRT446055	hsa-miR-548t-3p	PAR-CLIP	22100165
MIRT446054	hsa-miR-570-3p	PAR-CLIP	22100165
MIRT446053	hsa-miR-653-5p	PAR-CLIP	22100165
MIRT731579	hsa-miR-376c-3p	Luciferase reporter assay	27049310
MIRT731579	hsa-miR-376c-3p	Luciferase reporter assay	27049310
MIRT731579	hsa-miR-376c-3p	Luciferase reporter assay	27049310
MIRT731579	hsa-miR-376c-3p	Luciferase reporter assay	27049310
MIRT731579	hsa-miR-376c-3p	Luciferase reporter assay	27049310
MIRT731579	hsa-miR-376c-3p	Luciferase reporter assay	27049310
MIRT731758	hsa-miR-27b-3p	Luciferase reporter assayqRT-PCRWestern blot	27809310
MIRT731758	hsa-miR-27b-3p	Luciferase reporter assayqRT-PCRWestern blot	27809310
MIRT446057	hsa-miR-548aa	PAR-CLIP	22100165
MIRT446056	hsa-miR-548ap-3p	PAR-CLIP	22100165
MIRT446055	hsa-miR-548t-3p	PAR-CLIP	22100165
MIRT446054	hsa-miR-570-3p	PAR-CLIP	22100165
MIRT446053	hsa-miR-653-5p	PAR-CLIP	22100165
MIRT446057	hsa-miR-548aa	PAR-CLIP	22100165
MIRT446056	hsa-miR-548ap-3p	PAR-CLIP	22100165
MIRT446055	hsa-miR-548t-3p	PAR-CLIP	22100165
MIRT446054	hsa-miR-570-3p	PAR-CLIP	22100165
MIRT446053	hsa-miR-653-5p	PAR-CLIP	22100165
MIRT1193006	hsa-miR-1225-3p	CLIP-seq
MIRT1193007	hsa-miR-1233	CLIP-seq
MIRT1193008	hsa-miR-1273e	CLIP-seq
MIRT1193009	hsa-miR-1303	CLIP-seq
MIRT1193010	hsa-miR-1827	CLIP-seq
MIRT1193011	hsa-miR-3123	CLIP-seq
MIRT1193012	hsa-miR-3614-5p	CLIP-seq
MIRT1193013	hsa-miR-3925-5p	CLIP-seq
MIRT1193014	hsa-miR-3978	CLIP-seq
MIRT1193015	hsa-miR-4291	CLIP-seq
MIRT1193016	hsa-miR-4432	CLIP-seq
MIRT1193017	hsa-miR-4459	CLIP-seq
MIRT1193018	hsa-miR-4709-5p	CLIP-seq
MIRT1193019	hsa-miR-4714-3p	CLIP-seq
MIRT1193020	hsa-miR-4722-5p	CLIP-seq
MIRT1193021	hsa-miR-499-5p	CLIP-seq
MIRT1193022	hsa-miR-505	CLIP-seq
MIRT1193023	hsa-miR-545	CLIP-seq
MIRT1193024	hsa-miR-940	CLIP-seq
MIRT1193025	hsa-miR-103a	CLIP-seq
MIRT1193026	hsa-miR-107	CLIP-seq
MIRT1193027	hsa-miR-1185	CLIP-seq
MIRT1193028	hsa-miR-1224-5p	CLIP-seq
MIRT1193006	hsa-miR-1225-3p	CLIP-seq
MIRT1193007	hsa-miR-1233	CLIP-seq
MIRT1193029	hsa-miR-1265	CLIP-seq
MIRT1193030	hsa-miR-1272	CLIP-seq
MIRT1193008	hsa-miR-1273e	CLIP-seq
MIRT1193031	hsa-miR-1275	CLIP-seq
MIRT1193032	hsa-miR-1301	CLIP-seq
MIRT1193010	hsa-miR-1827	CLIP-seq
MIRT1193033	hsa-miR-200b	CLIP-seq
MIRT1193034	hsa-miR-200c	CLIP-seq
MIRT1193035	hsa-miR-2114	CLIP-seq
MIRT1193036	hsa-miR-2116	CLIP-seq
MIRT1193037	hsa-miR-2355-3p	CLIP-seq
MIRT1193038	hsa-miR-3121-5p	CLIP-seq
MIRT1193039	hsa-miR-33a	CLIP-seq
MIRT1193040	hsa-miR-33b	CLIP-seq
MIRT1193041	hsa-miR-3605-5p	CLIP-seq
MIRT1193042	hsa-miR-3675-5p	CLIP-seq
MIRT1193043	hsa-miR-3679-5p	CLIP-seq
MIRT1193044	hsa-miR-374c	CLIP-seq
MIRT1193045	hsa-miR-3915	CLIP-seq
MIRT1193046	hsa-miR-3929	CLIP-seq
MIRT1193047	hsa-miR-429	CLIP-seq
MIRT1193048	hsa-miR-4419b	CLIP-seq
MIRT1193049	hsa-miR-4433	CLIP-seq
MIRT1193017	hsa-miR-4459	CLIP-seq
MIRT1193050	hsa-miR-4478	CLIP-seq
MIRT1193051	hsa-miR-450b-5p	CLIP-seq
MIRT1193052	hsa-miR-451b	CLIP-seq
MIRT1193053	hsa-miR-4525	CLIP-seq
MIRT1193054	hsa-miR-4649-3p	CLIP-seq
MIRT1193055	hsa-miR-4659a-3p	CLIP-seq
MIRT1193056	hsa-miR-4659b-3p	CLIP-seq
MIRT1193057	hsa-miR-4665-5p	CLIP-seq
MIRT1193058	hsa-miR-4677-5p	CLIP-seq
MIRT1193059	hsa-miR-4689	CLIP-seq
MIRT1193060	hsa-miR-4699-5p	CLIP-seq
MIRT1193020	hsa-miR-4722-5p	CLIP-seq
MIRT1193061	hsa-miR-4723-5p	CLIP-seq
MIRT1193062	hsa-miR-485-5p	CLIP-seq
MIRT1193063	hsa-miR-5047	CLIP-seq
MIRT1193064	hsa-miR-507	CLIP-seq
MIRT1193065	hsa-miR-526b	CLIP-seq
MIRT1193066	hsa-miR-548a-5p	CLIP-seq
MIRT1193067	hsa-miR-548ab	CLIP-seq
MIRT1193068	hsa-miR-548ak	CLIP-seq
MIRT1193069	hsa-miR-548b-5p	CLIP-seq
MIRT1193070	hsa-miR-548c-5p	CLIP-seq
MIRT1193071	hsa-miR-548d-5p	CLIP-seq
MIRT1193072	hsa-miR-548h	CLIP-seq
MIRT1193073	hsa-miR-548i	CLIP-seq
MIRT1193074	hsa-miR-548j	CLIP-seq
MIRT1193075	hsa-miR-548k	CLIP-seq
MIRT1193076	hsa-miR-548l	CLIP-seq
MIRT1193077	hsa-miR-548w	CLIP-seq
MIRT1193078	hsa-miR-548y	CLIP-seq
MIRT1193079	hsa-miR-554	CLIP-seq
MIRT1193080	hsa-miR-557	CLIP-seq
MIRT1193081	hsa-miR-559	CLIP-seq
MIRT1193082	hsa-miR-625	CLIP-seq
MIRT1193083	hsa-miR-655	CLIP-seq
MIRT1193084	hsa-miR-665	CLIP-seq
MIRT1193085	hsa-miR-676	CLIP-seq
MIRT1193024	hsa-miR-940	CLIP-seq
MIRT2056030	hsa-miR-300	CLIP-seq
MIRT2056031	hsa-miR-381	CLIP-seq
MIRT2056032	hsa-miR-4802-5p	CLIP-seq
MIRT1193006	hsa-miR-1225-3p	CLIP-seq
MIRT1193007	hsa-miR-1233	CLIP-seq
MIRT1193008	hsa-miR-1273e	CLIP-seq
MIRT1193031	hsa-miR-1275	CLIP-seq
MIRT2284687	hsa-miR-1285	CLIP-seq
MIRT1193010	hsa-miR-1827	CLIP-seq
MIRT2284688	hsa-miR-3187-5p	CLIP-seq
MIRT2284689	hsa-miR-3194-5p	CLIP-seq
MIRT2284690	hsa-miR-3607-5p	CLIP-seq
MIRT2284691	hsa-miR-3922-5p	CLIP-seq
MIRT1193046	hsa-miR-3929	CLIP-seq
MIRT1193048	hsa-miR-4419b	CLIP-seq
MIRT1193049	hsa-miR-4433	CLIP-seq
MIRT1193017	hsa-miR-4459	CLIP-seq
MIRT1193050	hsa-miR-4478	CLIP-seq
MIRT2284692	hsa-miR-4495	CLIP-seq
MIRT1193053	hsa-miR-4525	CLIP-seq
MIRT2284693	hsa-miR-4643	CLIP-seq
MIRT1193054	hsa-miR-4649-3p	CLIP-seq
MIRT1193057	hsa-miR-4665-5p	CLIP-seq
MIRT1193020	hsa-miR-4722-5p	CLIP-seq
MIRT1193061	hsa-miR-4723-5p	CLIP-seq
MIRT2284694	hsa-miR-4753-5p	CLIP-seq
MIRT1193062	hsa-miR-485-5p	CLIP-seq
MIRT2284695	hsa-miR-548c-3p	CLIP-seq
MIRT2284696	hsa-miR-612	CLIP-seq
MIRT1193082	hsa-miR-625	CLIP-seq
MIRT2284697	hsa-miR-661	CLIP-seq
MIRT1193084	hsa-miR-665	CLIP-seq
MIRT1193024	hsa-miR-940	CLIP-seq
MIRT2582527	hsa-miR-3158-5p	CLIP-seq
MIRT2582528	hsa-miR-3689a-5p	CLIP-seq
MIRT2582529	hsa-miR-3689b	CLIP-seq
MIRT2582530	hsa-miR-3689e	CLIP-seq
MIRT2582531	hsa-miR-3689f	CLIP-seq
MIRT2582532	hsa-miR-3714	CLIP-seq
MIRT2582533	hsa-miR-4677-3p	CLIP-seq
MIRT2582534	hsa-miR-4679	CLIP-seq
MIRT2582527	hsa-miR-3158-5p	CLIP-seq
MIRT2582528	hsa-miR-3689a-5p	CLIP-seq
MIRT2582529	hsa-miR-3689b	CLIP-seq
MIRT2582530	hsa-miR-3689e	CLIP-seq
MIRT2582531	hsa-miR-3689f	CLIP-seq
MIRT2582532	hsa-miR-3714	CLIP-seq
MIRT2582533	hsa-miR-4677-3p	CLIP-seq
MIRT2582534	hsa-miR-4679	CLIP-seq

Show/Hide all (5)

Transcription factor	Regulation	Reference
CREB1	Activation	18191017
ESR1	Unknown	16091743
FOXA2	Activation	11595170
NR5A2	Activation	18191017
PROX1	Repression	19264593

100

Show/Hide all (100)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000976	Function	Transcription cis-regulatory region binding	IDA	15205472
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	ISS
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	TAS	9786908
GO:0001221	Function	Transcription coregulator binding	IEA
GO:0001221	Function	Transcription coregulator binding	IPI	14701856
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA
GO:0001545	Process	Primary ovarian follicle growth	IEA
GO:0001545	Process	Primary ovarian follicle growth	ISS
GO:0001826	Process	Inner cell mass cell differentiation	IEA
GO:0001826	Process	Inner cell mass cell differentiation	ISS
GO:0002669	Process	Positive regulation of T cell anergy	IEA
GO:0002669	Process	Positive regulation of T cell anergy	ISS
GO:0003677	Function	DNA binding	IDA	16289203
GO:0003677	Function	DNA binding	IEA
GO:0003682	Function	Chromatin binding	IEA
GO:0003682	Function	Chromatin binding	ISS
GO:0003690	Function	Double-stranded DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IDA	15205472, 15723037, 16289203
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0004879	Function	Nuclear receptor activity	IDA	15205472, 18410128, 21614002, 22187462, 22504882, 23737522, 26416531, 26553876, 27984042, 32433991, 38409506
GO:0004879	Function	Nuclear receptor activity	IEA
GO:0004879	Function	Nuclear receptor activity	TAS	16271724
GO:0005515	Function	Protein binding	IPI	12040021, 15143342, 15205472, 17664281, 19264593, 22187462, 22504882, 32296183
GO:0005543	Function	Phospholipid binding	IDA	15723037
GO:0005634	Component	Nucleus	IDA	28642062
GO:0005634	Component	Nucleus	IDA	15143342, 15205472
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005694	Component	Chromosome	IEA
GO:0005737	Component	Cytoplasm	IDA	15205472
GO:0006338	Process	Chromatin remodeling	IDA	38409506
GO:0006338	Process	Chromatin remodeling	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IDA	15723037
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	TAS	16289203
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0007283	Process	Spermatogenesis	IEA
GO:0007283	Process	Spermatogenesis	ISS
GO:0008206	Process	Bile acid metabolic process	IDA	21614002
GO:0008206	Process	Bile acid metabolic process	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0008289	Function	Lipid binding	IEA
GO:0009755	Process	Hormone-mediated signaling pathway	IBA
GO:0009792	Process	Embryo development ending in birth or egg hatching	TAS	16289203
GO:0009888	Process	Tissue development	IBA
GO:0022008	Process	Neurogenesis	IEA
GO:0022008	Process	Neurogenesis	ISS
GO:0030522	Process	Intracellular receptor signaling pathway	IEA
GO:0031017	Process	Exocrine pancreas development	IEA
GO:0031017	Process	Exocrine pancreas development	ISS
GO:0031948	Process	Positive regulation of glucocorticoid biosynthetic process	IEA
GO:0031948	Process	Positive regulation of glucocorticoid biosynthetic process	ISS
GO:0032331	Process	Negative regulation of chondrocyte differentiation	IEA
GO:0032331	Process	Negative regulation of chondrocyte differentiation	ISS
GO:0035019	Process	Somatic stem cell population maintenance	IEA
GO:0035019	Process	Somatic stem cell population maintenance	ISS
GO:0040016	Process	Embryonic cleavage	IEA
GO:0040016	Process	Embryonic cleavage	ISS
GO:0042102	Process	Positive regulation of T cell proliferation	IEA
GO:0042102	Process	Positive regulation of T cell proliferation	ISS
GO:0042127	Process	Regulation of cell population proliferation	IEA
GO:0042592	Process	Homeostatic process	NAS	16289203
GO:0042632	Process	Cholesterol homeostasis	IEA
GO:0043565	Function	Sequence-specific DNA binding	IDA	16289203
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0045070	Process	Positive regulation of viral genome replication	IDA	19264593
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	15143342
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	15205472, 27984042
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	ISS
GO:0046872	Function	Metal ion binding	IEA
GO:0050728	Process	Negative regulation of inflammatory response	IEA
GO:0050728	Process	Negative regulation of inflammatory response	ISS
GO:0050870	Process	Positive regulation of T cell activation	IEA
GO:0050870	Process	Positive regulation of T cell activation	ISS
GO:0051216	Process	Cartilage development	IEA
GO:0060009	Process	Sertoli cell development	IEA
GO:0060009	Process	Sertoli cell development	ISS
GO:0061113	Process	Pancreas morphogenesis	IEA
GO:0090425	Process	Acinar cell differentiation	IEA
GO:0090575	Component	RNA polymerase II transcription regulator complex	IBA
GO:0090575	Component	RNA polymerase II transcription regulator complex	IEA
GO:0090575	Component	RNA polymerase II transcription regulator complex	ISS
GO:0097720	Process	Calcineurin-mediated signaling	IEA
GO:0140001	Process	Morula formation	IEA
GO:0140001	Process	Morula formation	ISS
GO:0141064	Process	Zygotic genome activation	IEA
GO:0141064	Process	Zygotic genome activation	ISS
GO:1990830	Process	Cellular response to leukemia inhibitory factor	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536
GO:2000738	Process	Positive regulation of stem cell differentiation	IEA
GO:2000738	Process	Positive regulation of stem cell differentiation	ISS
GO:2001051	Process	Positive regulation of tendon cell differentiation	IEA
GO:2001051	Process	Positive regulation of tendon cell differentiation	ISS

MIM	HGNC	e!Ensembl
604453	7984	ENSG00000116833

O00482

Protein name

Nuclear receptor subfamily 5 group A member 2 (Alpha-1-fetoprotein transcription factor) (B1-binding factor) (hB1F) (CYP7A promoter-binding factor) (Hepatocytic transcription factor) (Liver receptor homolog 1) (LRH-1)

Protein function

Orphan nuclear receptor that binds DNA as a monomer to the 5'-TCAAGGCCA-3' sequence and controls expression of target genes: regulates key biological processes, such as early embryonic development, cholesterol and bile acid synthesis pathways, a

PDB

1YOK , 1YUC , 1ZDU , 2A66 , 3PLZ , 3TX7 , 4DOR , 4DOS , 4IS8 , 4ONI , 4PLD , 4PLE , 4RWV , 5L0M , 5L11 , 5SYZ , 5UNJ , 6OQX , 6OQY , 6OR1 , 6VC2 , 6VIF , 7JYD , 7JYE , 7TT8 , 8F8M , 8PKI

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00105	zf-C4	84 → 153	Zinc finger, C4 type (two domains)	Domain
PF00104	Hormone_recep	330 → 523	Ligand-binding domain of nuclear hormone receptor	Domain

Tissue specificity

TISSUE SPECIFICITY: Abundantly expressed in pancreas, less in liver, very low levels in heart and lung. Expressed in the Hep-G2 cell line (PubMed:9786908). Isoform 1 and isoform 2 seem to be present in fetal and adult liver and Hep-G2 cells (PubMed:103597

Sequence

MSSNSDTGDLQESLKHGLTPIGAGLPDRHGSPIPARGRLVMLPKVETEALGLARSHGEQG
QMPENMQVSQFKMVNYSYDEDLEELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNNKRY
TCIENQNCQIDKTQRKRCPYCRFQKCLSVGMKLEAVRADRMRGGRNKFGPMYKRDRALKQ
QKKALIRANGLKLEAMSQVIQAMPSDLTISSAIQNIHSASKGLPLNHAALPPTDYDRSPF
VTSPISMTMPPHGSLQGYQTYGHFPSRAIKSEYPDPYTSSPESIMGYSYMDSYQTSSPAS
IPHLILELLKCEPDEPQVQAKIMAYLQQEQANRSKHEKLSTFGLMCKMADQTLFSIVEWA
RSSIFFRELKVDDQMKLLQNCWSELLILDHIYRQVVHGKEGSIFLVTGQQVDYSIIASQA
GATLNNLMSHAQELVAKLRSLQFDQREFVCLKFLVLFSLDVKNLENFQLVEGVQEQVNAA
LLDYTMCNYPQQTEKFGQLLLRLPEIRAISMQAEEYLYYKHLNGDVPYNNLLIEMLHAKR
A

Sequence length

541

Interactions

View interactions

	KEGG		Reactome
	Maturity onset diabetes of the young		Nuclear Receptor transcription pathway SUMOylation of intracellular receptors Estrogen-dependent gene expression

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Anophthalmia-microphthalmia syndrome	Likely benign	rs139624279	RCV000207435
Long QT syndrome	Likely benign	rs774872040	RCV000190193
Premature ovarian failure	Conflicting classifications of pathogenicity	rs749896579	RCV001270190

Show/Hide Text Mining Associations (59)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Abortion Spontaneous	Associate	30044146
Adenocarcinoma	Associate	27586588, 30273983
Barrett Esophagus	Associate	27586588
Bone Diseases Metabolic	Associate	19629617
Breast Neoplasms	Associate	16091743, 23667258, 24785096, 32005108, 37551622
Breast Neoplasms	Stimulate	22359603
Carcinogenesis	Associate	25675535, 9786908
Carcinoma Ductal Breast	Associate	16091743
Carcinoma Hepatocellular	Associate	37204028
Carcinoma Non Small Cell Lung	Associate	30273983
Carcinoma Pancreatic Ductal	Associate	21949357, 22125638, 25742499, 36209277, 36302831
Chemical and Drug Induced Liver Injury	Associate	22504882
Colitis Ulcerative	Inhibit	17670946
Colitis Ulcerative	Associate	35058554
Colonic Diseases	Associate	23667258
Colorectal Neoplasms	Associate	23867710, 25675535, 28440426, 32037723
Colorectal Neoplasms	Inhibit	28081303
Crohn Disease	Inhibit	17670946
Crohn Disease	Associate	35058554
Death	Associate	25514243
Death	Inhibit	25514243
Death	Stimulate	36140779
Developmental Disabilities	Associate	22523087
Diabetes Mellitus	Associate	22504882, 31419141, 32631515
Disorder of Sex Development 46 XY	Associate	24405868
Disorders of Sex Development	Associate	24405868
Endometrial Neoplasms	Associate	36140779
Esophageal Neoplasms	Associate	24204738
Esophageal Squamous Cell Carcinoma	Associate	24204738
Gastroesophageal Reflux	Stimulate	27586588
Glioma	Associate	35285582, 36303447
Glomerulosclerosis Focal Segmental	Associate	36613637
Hepatoblastoma	Associate	30320362
Inflammation	Associate	17670946, 31419141
Inflammatory Bowel Diseases	Associate	17670946, 31419141
Intestinal Neoplasms	Associate	21949357
Lymphatic Metastasis	Associate	25514243
Lymphatic Metastasis	Stimulate	30273983
Lymphoma	Associate	18410452
Lymphoma B Cell Marginal Zone	Associate	18410452
Melanoma	Associate	24642353
Metabolic Diseases	Associate	26553876
Neointima	Associate	33622240
Neoplasm Metastasis	Associate	25514243, 30273983
Neoplasms	Associate	16091743, 18719914, 20101243, 23667258, 24785096, 25514243, 25675535, 27586588, 28081303, 30273983, 30320362, 32037723, 36140779
Neoplasms	Inhibit	22301800, 27579533, 37551622
Non alcoholic Fatty Liver Disease	Associate	31419141, 32631515
Obesity	Associate	21357378
Olfaction Disorders	Associate	27878761
Osteoporosis	Associate	19629617
Ovarian Diseases	Stimulate	35295989
Pancreatic Neoplasms	Associate	20101243, 21949357, 22125638, 24058443, 24642353, 26592175, 27579533, 27996162, 32456644, 33517887
Pancreatic Neoplasms	Inhibit	21357378
Pancreatitis	Associate	23667258
Pediatric acute onset neuropsychiatric syndrome	Associate	27878761
Polycystic Ovary Syndrome	Associate	37445796
Primary Ovarian Insufficiency	Associate	24405868
Schizophrenia	Associate	35058554
Stomach Neoplasms	Associate	25514243, 27983934

NR5A2 (nuclear receptor subfamily 5 group A member 2)