FRZB (frizzled related protein)

Gene

• Entrez ID: 2487
• Gene name: Frizzled related protein
• Gene symbol: FRZB
• Synonyms (NCBI Gene): FRE, FRITZ, FRP-3, FRZB-1, FRZB-PEN, FRZB1, FZRB, OS1, SFRP3, SRFP3, hFIZ
• Chromosome: 2
• Chromosome location: 2q32.1
• Summary: The protein encoded by this gene is a secreted protein that is involved in the regulation of bone development. Defects in this gene are a cause of female-specific osteoarthritis (OA) susceptibility. [provided by RefSeq, Apr 2010]

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs7775	G>A,C,T	Risk-factor	Coding sequence variant, missense variant
rs288326	G>A	Risk-factor	Coding sequence variant, missense variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT023431	hsa-miR-30b-5p	Sequencing	20371350
MIRT037469	hsa-miR-744-5p	CLASH	23622248
MIRT438841	hsa-miR-451a	qRT-PCR	23294929
MIRT438841	hsa-miR-451a	qRT-PCR	23294929
MIRT736853	hsa-miR-454-3p	Immunofluorescence, qRT-PCR	33820867
MIRT1005392	hsa-miR-1253	CLIP-seq
MIRT1005393	hsa-miR-1976	CLIP-seq
MIRT1005394	hsa-miR-3123	CLIP-seq
MIRT1005395	hsa-miR-3170	CLIP-seq
MIRT1005396	hsa-miR-3919	CLIP-seq
MIRT1005397	hsa-miR-3936	CLIP-seq
MIRT1005398	hsa-miR-4694-3p	CLIP-seq
MIRT1005399	hsa-miR-4738-3p	CLIP-seq
MIRT1005400	hsa-miR-4760-3p	CLIP-seq
MIRT1005401	hsa-miR-4782-5p	CLIP-seq
MIRT1005402	hsa-miR-522	CLIP-seq
MIRT1005403	hsa-miR-549	CLIP-seq
MIRT1005404	hsa-miR-579	CLIP-seq
MIRT1005405	hsa-miR-664	CLIP-seq
MIRT2449914	hsa-miR-33a	CLIP-seq
MIRT2449915	hsa-miR-33b	CLIP-seq
MIRT2449916	hsa-miR-3940-5p	CLIP-seq
MIRT2449917	hsa-miR-4507	CLIP-seq
MIRT2449918	hsa-miR-4793-5p	CLIP-seq
MIRT2449919	hsa-miR-586	CLIP-seq
MIRT2449914	hsa-miR-33a	CLIP-seq
MIRT2449915	hsa-miR-33b	CLIP-seq
MIRT2449916	hsa-miR-3940-5p	CLIP-seq
MIRT2449917	hsa-miR-4507	CLIP-seq
MIRT2449918	hsa-miR-4793-5p	CLIP-seq
MIRT2449919	hsa-miR-586	CLIP-seq
MIRT2449914	hsa-miR-33a	CLIP-seq
MIRT2449915	hsa-miR-33b	CLIP-seq
MIRT2449916	hsa-miR-3940-5p	CLIP-seq
MIRT2449917	hsa-miR-4507	CLIP-seq
MIRT2449918	hsa-miR-4793-5p	CLIP-seq
MIRT2449919	hsa-miR-586	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001501	Process	Skeletal system development	IEA
GO:0001501	Process	Skeletal system development	TAS	8824257
GO:0002064	Process	Epithelial cell development	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	HDA	20551380
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	ISS
GO:0005737	Component	Cytoplasm	IBA
GO:0008285	Process	Negative regulation of cell population proliferation	IDA	20208569
GO:0008285	Process	Negative regulation of cell population proliferation	IEA
GO:0010721	Process	Negative regulation of cell development	IEA
GO:0014033	Process	Neural crest cell differentiation	IEA
GO:0016020	Component	Membrane	TAS	8824257
GO:0016055	Process	Wnt signaling pathway	IEA
GO:0017147	Function	Wnt-protein binding	IBA
GO:0017147	Function	Wnt-protein binding	IEA
GO:0017147	Function	Wnt-protein binding	ISS
GO:0017147	Function	Wnt-protein binding	NAS	24431302
GO:0030154	Process	Cell differentiation	IEA
GO:0030178	Process	Negative regulation of Wnt signaling pathway	IDA	20208569
GO:0030178	Process	Negative regulation of Wnt signaling pathway	IEA
GO:0030178	Process	Negative regulation of Wnt signaling pathway	ISS
GO:0030178	Process	Negative regulation of Wnt signaling pathway	NAS	24431302
GO:0030308	Process	Negative regulation of cell growth	IDA	20208569
GO:0035567	Process	Non-canonical Wnt signaling pathway	IBA
GO:0042472	Process	Inner ear morphogenesis	IEA
GO:0043065	Process	Positive regulation of apoptotic process	IEA
GO:0043065	Process	Positive regulation of apoptotic process	IGI	18166153
GO:0045595	Process	Regulation of cell differentiation	IEA
GO:0045600	Process	Positive regulation of fat cell differentiation	IDA	12055200
GO:0060029	Process	Convergent extension involved in organogenesis	IEA
GO:0060070	Process	Canonical Wnt signaling pathway	IBA
GO:0061037	Process	Negative regulation of cartilage development	IEA
GO:0061053	Process	Somite development	IEA
GO:0070365	Process	Hepatocyte differentiation	IEA
GO:0070367	Process	Negative regulation of hepatocyte differentiation	IEA
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IDA	17471511
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IEA
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IEA
GO:0090103	Process	Cochlea morphogenesis	IEA

Other IDs

• MIM: 605083
• HGNC: 3959
• e!Ensembl: ENSG00000162998

Protein

• UniProt ID: Q92765
• Protein name: Secreted frizzled-related protein 3 (sFRP-3) (Frezzled) (Fritz) (Frizzled-related protein 1) (FrzB-1)
• Protein function: Soluble frizzled-related proteins (sFRPS) function as modulators of Wnt signaling through direct interaction with Wnts. They have a role in regulating cell growth and differentiation in specific cell types. SFRP3/FRZB appears to be involved in l
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01392	Fz	35 → 144	Fz domain	Domain
  PF01759	NTR	188 → 291	UNC-6/NTR/C345C module	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed primarily in the cartilaginous cores of the long bone during embryonic and fetal development and in the appendicular skeleton (6-13 weeks). At 13 weeks of gestation, transcripts were present in early chondroblasts of the tars
• Sequence:

  MVCGSPGGMLLLRAGLLALAALCLLRVPGARAAACEPVRIPLCKSLPWNMTKMPNHLHHS
  TQANAILAIEQFEGLLGTHCSPDLLFFLCAMYAPICTIDFQHEPIKPCKSVCERARQGCE
  PILIKYRHSWPENLACEELPVYDRGVCISPEAIVTADGADFPMDSSNGNCRGASSERCKC
  KPIRATQKTYFRNNYNYVIRAKVKEIKTKCHDVTAVVEVKEILKSSLVNIPRDTVNLYTS
  SGCLCPPLNVNEEYIIMGYEDEERSRLLLVEGSIAEKWKDRLGKKVKRWDMKLRHLGLSK
  SDSSNSDSTQSQKSGRNSNPRQARN

• Sequence length: 325

Pathways

KEGG:

Wnt signaling pathway

<