ALOX15B (arachidonate 15-lipoxygenase type B)

Gene

• Entrez ID: 247
• Gene name: Arachidonate 15-lipoxygenase type B
• Gene symbol: ALOX15B
• Synonyms (NCBI Gene): 15-LOX-2
• Chromosome: 17
• Chromosome location: 17p13.1
• Summary: This gene encodes a member of the lipoxygenase family of structurally related nonheme iron dioxygenases involved in the production of fatty acid hydroperoxides. The encoded protein converts arachidonic acid exclusively to 15S-hydroperoxyeicosatetraenoic a

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT778912	hsa-miR-323-5p	CLIP-seq
MIRT778913	hsa-miR-4424	CLIP-seq
MIRT778914	hsa-miR-4447	CLIP-seq
MIRT778915	hsa-miR-4472	CLIP-seq
MIRT778916	hsa-miR-541	CLIP-seq
MIRT778917	hsa-miR-654-5p	CLIP-seq
MIRT778918	hsa-miR-876-3p	CLIP-seq
MIRT2170696	hsa-miR-3115	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
SP1	Unknown	15247906

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005506	Function	Iron ion binding	IDA	24497644
GO:0005506	Function	Iron ion binding	IEA
GO:0005509	Function	Calcium ion binding	IDA	24497644
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005634	Component	Nucleus	IDA	12704195
GO:0005634	Component	Nucleus	IDA	12704195
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA	10542053, 12704195
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IDA	12704195
GO:0005856	Component	Cytoskeleton	IEA
GO:0005886	Component	Plasma membrane	IDA	12704195, 27435673
GO:0005886	Component	Plasma membrane	IEA
GO:0005912	Component	Adherens junction	IDA	12704195
GO:0005912	Component	Adherens junction	IEA
GO:0005925	Component	Focal adhesion	IDA	12704195
GO:0005925	Component	Focal adhesion	IEA
GO:0006629	Process	Lipid metabolic process	IDA	17493578, 18311922
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006629	Process	Lipid metabolic process	TAS	11839751
GO:0006644	Process	Phospholipid metabolic process	IDA	27435673
GO:0006644	Process	Phospholipid metabolic process	IEA
GO:0006915	Process	Apoptotic process	TAS	11839751
GO:0008285	Process	Negative regulation of cell population proliferation	IDA	11839751
GO:0008285	Process	Negative regulation of cell population proliferation	IMP	12704195
GO:0008289	Function	Lipid binding	IEA
GO:0010744	Process	Positive regulation of macrophage derived foam cell differentiation	IMP	22912809
GO:0016020	Component	Membrane	IDA	10542053, 24497644
GO:0016020	Component	Membrane	IEA
GO:0016165	Function	Linoleate 13S-lipoxygenase activity	IDA	10542053
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0016702	Function	Oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen	IEA
GO:0019369	Process	Arachidonate metabolic process	IBA
GO:0019369	Process	Arachidonate metabolic process	IDA	9177185, 10542053, 10625675, 24282679, 24497644, 27145229
GO:0019369	Process	Arachidonate metabolic process	IEA
GO:0019372	Process	Lipoxygenase pathway	IBA
GO:0019372	Process	Lipoxygenase pathway	IEA
GO:0030336	Process	Negative regulation of cell migration	TAS	11839751
GO:0030850	Process	Prostate gland development	NAS	11839751
GO:0030856	Process	Regulation of epithelial cell differentiation	NAS	11839751
GO:0032722	Process	Positive regulation of chemokine production	IMP	18067895
GO:0034440	Process	Lipid oxidation	IBA
GO:0034440	Process	Lipid oxidation	IEA
GO:0035360	Process	Positive regulation of peroxisome proliferator activated receptor signaling pathway	IEA
GO:0036403	Function	Arachidonate 8(S)-lipoxygenase activity	IEA
GO:0043651	Process	Linoleic acid metabolic process	IBA
GO:0043651	Process	Linoleic acid metabolic process	IEA
GO:0045618	Process	Positive regulation of keratinocyte differentiation	IEA
GO:0045786	Process	Negative regulation of cell cycle	IDA	11839751
GO:0045926	Process	Negative regulation of growth	IDA	11839751
GO:0046872	Function	Metal ion binding	IEA
GO:0050473	Function	Arachidonate 15-lipoxygenase activity	IBA
GO:0050473	Function	Arachidonate 15-lipoxygenase activity	IDA	9177185, 10542053, 10625675, 11956198, 17493578, 18311922, 24282679, 24497644, 27145229, 27435673
GO:0050473	Function	Arachidonate 15-lipoxygenase activity	IEA
GO:0051122	Process	Hepoxilin biosynthetic process	IBA
GO:0051122	Process	Hepoxilin biosynthetic process	ISS
GO:0051213	Function	Dioxygenase activity	IEA
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:0070161	Component	Anchoring junction	IEA
GO:0071926	Process	Endocannabinoid signaling pathway	IDA	11956198
GO:1901696	Process	Cannabinoid biosynthetic process	IDA	11956198
GO:1990136	Function	Linoleate 9S-lipoxygenase activity	IEA
GO:2001303	Process	Lipoxin A4 biosynthetic process	IDA	27145229

Other IDs

• MIM: 603697
• HGNC: 434
• e!Ensembl: ENSG00000179593

Protein

• UniProt ID: O15296
• Protein name: Polyunsaturated fatty acid lipoxygenase ALOX15B (15-lipoxygenase 2) (15-LOX-2) (Arachidonate 15-lipoxygenase B) (15-LOX-B) (EC 1.13.11.33) (Arachidonate 15-lipoxygenase type II) (Linoleate 13-lipoxygenase 15-LOb) (EC 1.13.11.-)
• Protein function: [Isoform A]: Non-heme iron-containing dioxygenase that catalyzes the stereo-specific peroxidation of free and esterified polyunsaturated fatty acids (PUFAs) generating a spectrum of bioactive lipid mediators (Probable) (PubMed:10542053, PubMed:1
• PDB: 4NRE, 7LAF, 8VIY
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01477	PLAT	4 → 119	PLAT/LH2 domain	Domain
  PF00305	Lipoxygenase	175 → 661	Lipoxygenase	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in hair, prostate, lung, ovary, lymph node, spinal cord and cornea. {ECO:0000269|PubMed:10542053, ECO:0000269|PubMed:11350124, ECO:0000269|PubMed:9177185}.
• Sequence:

  MAEFRVRVSTGEAFGAGTWDKVSVSIVGTRGESPPLPLDNLGKEFTAGAEEDFQVTLPED
  VGRVLLLRVHKAPPVLPLLGPLAPDAWFCRWFQLTPPRGGHLLFPCYQWLEGAGTLVLQE
  GTAKVSWADHHPVLQQQRQEELQARQEMYQWKAYNPGWPHCLDEKTVEDLELNIKYSTAK
  NANFYLQAGSAFAEMKIKGLLDRKGLWRSLNEMKRIFNFRRTPAAEHAFEHWQEDAFFAS
  QFLNGLNPVLIRRCHYLPKNFPVTDAMVASVLGPGTSLQAELEKGSLFLVDHGILSGIQT
  NVINGKPQFSAAPMTLLYQSPGCGPLLPLAIQLSQTPGPNSPIFLPTDDKWDWLLAKTWV
  RNAEFSFHEALTHLLHSHLLPEVFTLATLRQLPHCHPLFKLLIPHTRYTLHINTLARELL
  IVPGQVVDRSTGIGIEGFSELIQRNMKQLNYSLLCLPEDIRTRGVEDIPGYYYRDDGMQI
  WGAVERFVSEIIGIYYPSDESVQDDRELQAWVREIFSKGFLNQESSGIPSSLETREALVQ
  YVTMVIFTCSAKHAAVSAGQFDSCAWMPNLPPSMQLPPPTSKGLATCEGFIATLPPVNAT
  CDVILALWLLSKEPGDQRPLGTYPDEHFTEEAPRRSIATFQSRLAQISRGIQERNQGLVL
  PYTYLDPPLIENSVSI

• Sequence length: 676

Pathways

KEGG:

Arachidonic acid metabolism
Metabolic pathways
Serotonergic synapse

Reactome:

Synthesis of 15-eicosatetraenoic acid derivatives

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
AUTISM SPECTRUM DISORDER	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VENOUS THROMBOEMBOLISM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Relationship Type	References	Evidence Score
Adenocarcinoma	Inhibit	11571629	★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of Lung	Associate	39259123	★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Associate	16357157	★☆☆☆☆ Found in Text Mining only
Blood Platelet Disorders	Stimulate	24533104	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Associate	26331820	★☆☆☆☆ Found in Text Mining only
Carcinoma Non Small Cell Lung	Inhibit	26331820	★☆☆☆☆ Found in Text Mining only
Carcinoma Non Small Cell Lung	Associate	28704416	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Associate	33717076	★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Associate	30138423	★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Associate	24533104	★☆☆☆☆ Found in Text Mining only
COVID 19	Stimulate	37603745	★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Inhibit	12659684	★☆☆☆☆ Found in Text Mining only
Failed Back Surgery Syndrome	Associate	30138423	★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Inhibit	16874012	★☆☆☆☆ Found in Text Mining only
Hypoxia	Stimulate	30138423	★☆☆☆☆ Found in Text Mining only
Hypoxia Brain	Associate	30138423	★☆☆☆☆ Found in Text Mining only
Inflammation	Inhibit	32107839	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Stimulate	37603745	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Stimulate	19170196	★☆☆☆☆ Found in Text Mining only
Neoplasms	Inhibit	12189136, 12659684, 12704195, 16874012	★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	15799828, 16000313, 26331820, 31288808, 33717076	★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Stimulate	31288808	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Inhibit	11839751	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Associate	23066085	★☆☆☆☆ Found in Text Mining only
Prostatitis	Associate	11839751, 12189136, 12704195	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Inhibit	16874012	★☆☆☆☆ Found in Text Mining only
Thrombosis	Stimulate	24533104	★☆☆☆☆ Found in Text Mining only