IL27 (interleukin 27)

Gene
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
246778
Gene name Gene Name - the full gene name approved by the HGNC.
Interleukin 27
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
IL27
Synonyms (NCBI Gene) Gene synonyms aliases
IL-27, IL-27A, IL27A, IL27p28, IL30, p28
Chromosome Chromosome number
16
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
16p12.1-p11.2
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is one of the subunits of a heterodimeric cytokine complex. This protein is related to interleukin 12A (IL12A). It interacts with Epstein-Barr virus induced gene 3 (EBI3), a protein similar to interleukin 12B (IL12B), and
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(19)
miRTarBase ID miRNA Experiments Reference
MIRT017242 hsa-miR-335-5p Microarray 18185580
MIRT1064686 hsa-miR-1538 CLIP-seq
MIRT1064687 hsa-miR-328 CLIP-seq
MIRT1064688 hsa-miR-338-3p CLIP-seq
MIRT1064689 hsa-miR-4488 CLIP-seq
Transcription factors
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(3)
Transcription factor Regulation Reference
IRF1 Activation 17684041;20083668
IRF9 Repression 20083668
STAT1 Unknown 22761702
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(32)
GO ID Ontology Definition Evidence Reference
GO:0002230 Process Positive regulation of defense response to virus by host IEA
GO:0002376 Process Immune system process IEA
GO:0005102 Function Signaling receptor binding IEA
GO:0005102 Function Signaling receptor binding ISS
GO:0005125 Function Cytokine activity IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
608273 19157 ENSG00000197272
Protein
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Q8NEV9
Protein name Interleukin-27 subunit alpha (IL-27 subunit alpha) (IL-27-A) (IL27-A) (Interleukin-30) (p28)
Protein function Associates with EBI3 to form the IL-27 interleukin, a heterodimeric cytokine which functions in innate immunity. IL-27 has pro- and anti-inflammatory properties, that can regulate T-helper cell development, suppress T-cell proliferation, stimula
PDB 7U7N , 7ZXK , 8D85 , 8XWY
Family and domains
Tissue specificity TISSUE SPECIFICITY: Expressed in monocytes and in placenta. {ECO:0000269|PubMed:12121660}.
Sequence 
MGQTAGDLGWRLSLLLLPLLLVQAGVWGFPRPPGRPQLSLQELRREFTVSLHLARKLLSE
VRGQAHRFAESHLPGVNLYLLPLGEQLPDVSLTFQAWRRLSDPERLCFISTTLQPFHALL
GGLGTQGRWTNMERMQLWAMRLDLRDLQRHLRFQVLAAGFNLPEEEEEEEEEEEEERKGL
LPGALGSALQGPAQVSWPQLLSTYRLLHSLELVLSRAVRELLLLSKAGHSVWPLGFPTLS
PQP
Sequence length 243
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG   Reactome
  Cytokine-cytokine receptor interaction
JAK-STAT signaling pathway
Th17 cell differentiation 		  Interleukin-27 signaling
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Unknown Diseases (3)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Crohn Disease Crohn's disease, Crohn's disease or Leprosy (opposite effect) N/A N/A GWAS
Inflammatory Bowel Disease Inflammatory bowel disease, Inflammatory bowel disease (MTAG) N/A N/A GWAS
Ulcerative colitis Ulcerative colitis N/A N/A GWAS
Show/Hide Text Mining Associations (151)
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Acute On Chronic Liver Failure Associate 31198792
Alveolitis Extrinsic Allergic Stimulate 29187726
Anemia Aplastic Stimulate 21506940
Angina Stable Stimulate 23285065
Angina Unstable Stimulate 23285065
Arthritis Juvenile Associate 36362342
Arthritis Psoriatic Stimulate 19924133
Arthritis Rheumatoid Associate 20604932, 20971923, 25041531, 28552197, 28738904, 32616337, 34558072
Arthritis Rheumatoid Stimulate 27869736, 37678876
Asthma Associate 24560518