IL27 (interleukin 27)

Gene

• Entrez ID: 246778
• Gene name: Interleukin 27
• Gene symbol: IL27
• Synonyms (NCBI Gene): IL-27, IL-27A, IL27A, IL27p28, IL30, p28
• Chromosome: 16
• Chromosome location: 16p12.1-p11.2
• Summary: The protein encoded by this gene is one of the subunits of a heterodimeric cytokine complex. This protein is related to interleukin 12A (IL12A). It interacts with Epstein-Barr virus induced gene 3 (EBI3), a protein similar to interleukin 12B (IL12B), and

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT017242	hsa-miR-335-5p	Microarray	18185580
MIRT1064686	hsa-miR-1538	CLIP-seq
MIRT1064687	hsa-miR-328	CLIP-seq
MIRT1064688	hsa-miR-338-3p	CLIP-seq
MIRT1064689	hsa-miR-4488	CLIP-seq
MIRT1064690	hsa-miR-4697-5p	CLIP-seq
MIRT1064691	hsa-miR-4745-3p	CLIP-seq
MIRT2015386	hsa-miR-1207-5p	CLIP-seq
MIRT2015387	hsa-miR-1909	CLIP-seq
MIRT2015388	hsa-miR-4447	CLIP-seq
MIRT2015389	hsa-miR-4472	CLIP-seq
MIRT2015390	hsa-miR-4489	CLIP-seq
MIRT2015391	hsa-miR-4763-3p	CLIP-seq
MIRT2015392	hsa-miR-486-3p	CLIP-seq
MIRT2451757	hsa-miR-3131	CLIP-seq
MIRT2451758	hsa-miR-3184	CLIP-seq
MIRT2451759	hsa-miR-423-5p	CLIP-seq
MIRT2451760	hsa-miR-4751	CLIP-seq
MIRT2451761	hsa-miR-611	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
IRF1	Activation	17684041;20083668
IRF9	Repression	20083668
STAT1	Unknown	22761702

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002230	Process	Positive regulation of defense response to virus by host	IEA
GO:0002376	Process	Immune system process	IEA
GO:0005102	Function	Signaling receptor binding	IEA
GO:0005102	Function	Signaling receptor binding	ISS
GO:0005125	Function	Cytokine activity	IEA
GO:0005515	Function	Protein binding	IPI	19933857, 20974977
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IEA
GO:0005615	Component	Extracellular space	ISS
GO:0005788	Component	Endoplasmic reticulum lumen	TAS
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006954	Process	Inflammatory response	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0009617	Process	Response to bacterium	IEA
GO:0009986	Component	Cell surface	IEA
GO:0032729	Process	Positive regulation of type II interferon production	IDA	12734330
GO:0042129	Process	Regulation of T cell proliferation	IBA
GO:0042129	Process	Regulation of T cell proliferation	IEA
GO:0042129	Process	Regulation of T cell proliferation	IEA
GO:0042129	Process	Regulation of T cell proliferation	ISS
GO:0045087	Process	Innate immune response	IEA
GO:0045523	Function	Interleukin-27 receptor binding	IBA
GO:0045523	Function	Interleukin-27 receptor binding	IEA
GO:0045523	Function	Interleukin-27 receptor binding	ISS
GO:0045625	Process	Regulation of T-helper 1 cell differentiation	IBA
GO:0045625	Process	Regulation of T-helper 1 cell differentiation	IDA	12734330
GO:0050688	Process	Regulation of defense response to virus	IEA
GO:0050863	Process	Regulation of T cell activation	IEA
GO:0140459	Process	Response to Gram-positive bacterium	IEA

Other IDs

• MIM: 608273
• HGNC: 19157
• e!Ensembl: ENSG00000197272

Protein

• UniProt ID: Q8NEV9
• Protein name: Interleukin-27 subunit alpha (IL-27 subunit alpha) (IL-27-A) (IL27-A) (Interleukin-30) (p28)
• Protein function: Associates with EBI3 to form the IL-27 interleukin, a heterodimeric cytokine which functions in innate immunity. IL-27 has pro- and anti-inflammatory properties, that can regulate T-helper cell development, suppress T-cell proliferation, stimula
• PDB: 7U7N, 7ZXK, 8D85, 8XWY
• Tissue specificity: TISSUE SPECIFICITY: Expressed in monocytes and in placenta. {ECO:0000269|PubMed:12121660}.
• Sequence:

  MGQTAGDLGWRLSLLLLPLLLVQAGVWGFPRPPGRPQLSLQELRREFTVSLHLARKLLSE
  VRGQAHRFAESHLPGVNLYLLPLGEQLPDVSLTFQAWRRLSDPERLCFISTTLQPFHALL
  GGLGTQGRWTNMERMQLWAMRLDLRDLQRHLRFQVLAAGFNLPEEEEEEEEEEEEERKGL
  LPGALGSALQGPAQVSWPQLLSTYRLLHSLELVLSRAVRELLLLSKAGHSVWPLGFPTLS
  PQP

• Sequence length: 243

Pathways

KEGG:

Cytokine-cytokine receptor interaction
JAK-STAT signaling pathway
Th17 cell differentiation

Reactome:

Interleukin-27 signaling