LINC00315 (long intergenic non-protein coding RNA 315)

Gene Gene information from NCBI Gene database.
Gene Other IDs Protein
Entrez ID 246704
Gene name Long intergenic non-protein coding RNA 315
Gene symbol LINC00315
Synonyms (NCBI Gene)
C21orf93NCRNA00315
Chromosome 21
Chromosome location 21q22.3
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene Other IDs Protein
MIM HGNC e!Ensembl
HGNC 16621 N/A
Protein Protein information from UniProt database.
Gene Other IDs Protein
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P59091
Protein name Putative uncharacterized protein encoded by LINC00315
Family and domains
Tissue specificity TISSUE SPECIFICITY: Widely expressed. {ECO:0000269|PubMed:12036297}.
Sequence 
MDSLTERCRPQPLAALGPADAQLHGPAAAGGGVGPRVMLSSLCREHPWQGRCPPIPAHGK
EVRQLRHLHRTRPPDTHQDMARGPGLPHTHGLPARPSHVRHQTEPVQVASRWHVPSDGLC
RPCHVHQLLHPPLVPALGA
Sequence length 139
Interactions View interactions