Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
245934
Gene name Gene Name - the full gene name approved by the HGNC.
Defensin beta 121
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
DEFB121
Synonyms (NCBI Gene) Gene synonyms aliases
DEFB21, ESC42RELC
Chromosome Chromosome number
20
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
20q11.21
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the beta subfamily of defensins. Beta-defensins are antimicrobial peptides that protect tissues and organs from infection by a variety of microorganisms. This gene is found in a cluster with other beta-defensin genes on the l
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT931931 hsa-miR-1205 CLIP-seq
MIRT931932 hsa-miR-4418 CLIP-seq
MIRT931933 hsa-miR-4480 CLIP-seq
MIRT931934 hsa-miR-509-3-5p CLIP-seq
MIRT931935 hsa-miR-509-5p CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 25416956, 32296183
GO:0005576 Component Extracellular region IEA
GO:0006952 Process Defense response IEA
GO:0042742 Process Defense response to bacterium IEA
GO:0045087 Process Innate immune response IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
616075 18101 ENSG00000204548
Protein
UniProt ID Q5J5C9
Protein name Beta-defensin 121 (Beta-defensin 21) (DEFB-21) (Defensin, beta 121)
Protein function Has antibacterial activity.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13841 Defensin_beta_2 22 51 Beta defensin Domain
Tissue specificity TISSUE SPECIFICITY: Abundant expression in the male reproductive tract only. {ECO:0000269|PubMed:15772680}.
Sequence
MKLLLLLLTVTLLLAQVTPVMKCWGKSGRCRTTCKESEVYYILCKTEAKCCVDPKYVPVK
PKLTDTNTSLESTSAV
Sequence length 76
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Beta defensins
Defensins
<