Gene Gene information from NCBI Gene database.
Entrez ID 245711
Gene name Speedy/RINGO cell cycle regulator family member A
Gene symbol SPDYA
Synonyms (NCBI Gene)
RINGO3RINGOASPDY1SPY1
Chromosome 2
Chromosome location 2p23.2
miRNA miRNA information provided by mirtarbase database.
87
miRTarBase ID miRNA Experiments Reference
MIRT018986 hsa-miR-335-5p Microarray 18185580
MIRT2337546 hsa-miR-1245b-3p CLIP-seq
MIRT2337547 hsa-miR-3145-5p CLIP-seq
MIRT2337548 hsa-miR-508-5p CLIP-seq
MIRT2460362 hsa-miR-299-5p CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
27
GO ID Ontology Definition Evidence Reference
GO:0000082 Process G1/S transition of mitotic cell cycle IBA
GO:0000082 Process G1/S transition of mitotic cell cycle IDA 11980914
GO:0000781 Component Chromosome, telomeric region IEA
GO:0001741 Component XY body IEA
GO:0005515 Function Protein binding IPI 32296183
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
614029 30613 ENSG00000163806
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q5MJ70
Protein name Speedy protein A (Rapid inducer of G2/M progression in oocytes A) (RINGO A) (hSpy/Ringo A) (Speedy-1) (Spy1)
Protein function Regulates the G1/S phase transition of the cell cycle by binding and activating CDK1 and CDK2 (PubMed:12972555). Contributes to CDK2 activation without promoting CDK2 phosphorylation, by inducing a conformation change of the CDK2 T-loop that obs
PDB 5UQ1 , 5UQ2 , 5UQ3 , 7E34
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF11357 Spy1 69 199 Cell cycle regulatory protein Family
Tissue specificity TISSUE SPECIFICITY: Highly expressed in testis. Expressed at a low level in wide range of tissues including bone marrow, brain, heart, kidney, colon, liver, placenta, spleen, skeletal muscle, salivary gland, thyroid gland, thymus, trachea and uterus. Expr
Sequence
MRHNQMCCETPPTVTVYVKSGSNRSHQPKKPITLKRPICKDNWQAFEKNTHNNNKSKRPK
GPCLVIQRQDMTAFFKLFDDDLIQDFLWMDCCCKIADKYLLAMTFVYFKRAKFTISEHTR
INFFIALYLANTVEEDEEETKYEIFPWALGKNWRKLFPNFLKLRDQLWDRIDYRAIVSRR
CCEEVMAIAPTHYIWQRER
SVHHSGAVRNYNRDEVQLPRGPSATPVDCSLCGKKRRYVRL
GLSSSSSLSSHTAGVTEKHSQDSYNSLSMDIIGDPSQAYTGSEVVNDHQSNKGKKTNFLK
KDKSMEWFTGSEE
Sequence length 313
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG 
  Oocyte meiosis
Progesterone-mediated oocyte maturation