Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
24147
Gene name Gene Name - the full gene name approved by the HGNC.
Four-jointed box kinase 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
FJX1
Synonyms (NCBI Gene) Gene synonyms aliases
-
Chromosome Chromosome number
11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
11p13
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is the human ortholog of mouse and Drosophila four-jointed gene product. The Drosophila protein is important for growth and differentiation of legs and wings, and for proper development of the eyes. The exact function of t
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT040642 hsa-miR-92b-3p CLASH 23622248
MIRT266060 hsa-miR-548a-3p HITS-CLIP 23824327
MIRT266064 hsa-miR-548ar-3p HITS-CLIP 23824327
MIRT266066 hsa-miR-548az-3p HITS-CLIP 23824327
MIRT266061 hsa-miR-548e-3p HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005615 Component Extracellular space IBA 21873635
GO:0007267 Process Cell-cell signaling IBA 21873635
GO:0010842 Process Retina layer formation IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
612206 17166 ENSG00000179431
Protein
UniProt ID Q86VR8
Protein name Four-jointed box protein 1 (Four-jointed protein homolog)
Protein function Acts as an inhibitor of dendrite extension and branching.
Family and domains
Sequence
MGRRMRGAAATAGLWLLALGSLLALWGGLLPPRTELPASRPPEDRLPRRPARSGGPAPAP
RFPLPPPLAWDARGGSLKTFRALLTLAAGADGPPRQSRSEPRWHVSARQPRPEESAAVHG
GVFWSRGLEEQVPPGFSEAQAAAWLEAARGARMVALERGGCGRSSNRLARFADGTRACVR
YGINPEQIQGEALSYYLARLLGLQRHVPPLALARVEARGAQWAQVQEELRAAHWTEGSVV
SLTRWLPNLTDVVVPAPWRSEDGRLRPLRDAGGELANLSQAELVDLVQWTDLILFDYLTA
NFDRLVSNLFSLQWDPRVMQRATSNLHRGPGGALVFLDNEAGLVHGYRVAGMWDKYNEPL
LQSVCVFRERTARRVLELHRGQDAAARLLRLYRRHEPRFPELAALADPHAQLLQRRLDFL
AKHILHCKAKYGRRSGT
Sequence length 437
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Unknown
Disease term Disease name Evidence References Source
Brain neoplasms Brain Neoplasms, Malignant neoplasm of brain, Benign neoplasm of brain, unspecified, Brain Tumor, Primary, Recurrent Brain Neoplasm, Primary malignant neoplasm of brain 27935819 ClinVar
Associations from Text Mining
Disease Name Relationship Type References
Breast Neoplasms Associate 30193086
Diabetes Mellitus Type 2 Associate 35271662
Dyslipidemias Associate 37582372
Head and Neck Neoplasms Stimulate 31236144
Nasopharyngeal Carcinoma Stimulate 31236144
Neoplasms Associate 30193086, 31236144
Ovarian Neoplasms Stimulate 31236144
Sarcopenia Associate 35271662
Squamous Cell Carcinoma of Head and Neck Associate 30193086