Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	240
Gene name	Arachidonate 5-lipoxygenase
Gene symbol	ALOX5
Synonyms (NCBI Gene)	5-LO5-LOX5LPGLOG5
Chromosome	10
Chromosome location	10q11.21
Summary	This gene encodes a member of the lipoxygenase gene family and plays a dual role in the synthesis of leukotrienes from arachidonic acid. The encoded protein, which is expressed specifically in bone marrow-derived cells, catalyzes the conversion of arachid

Show/Hide all (9)

miRTarBase ID	miRNA	Experiments	Reference
MIRT736469	hsa-miR-125a-3p	RNA-seqImmunofluorescence	33205517
MIRT736470	hsa-let-7e-3p	RNA-seqImmunofluorescence	33205517
MIRT736469	hsa-miR-125a-3p	RNA-seqImmunofluorescence	33205517
MIRT778919	hsa-miR-186	CLIP-seq
MIRT778920	hsa-miR-3688-3p	CLIP-seq
MIRT778921	hsa-miR-3978	CLIP-seq
MIRT778922	hsa-miR-4694-3p	CLIP-seq
MIRT778923	hsa-miR-4699-5p	CLIP-seq
MIRT778924	hsa-miR-522	CLIP-seq

Show/Hide all (13)

Transcription factor	Regulation	Reference
EGR1	Activation	9062372
EGR1	Repression	15517885
EGR1	Unknown	10436859
HDAC2	Activation	21883892
HDAC3	Activation	21883892
MBD1	Repression	19781662
MBD2	Unknown	19781662
MECP2	Unknown	19781662
NFKB1	Repression	15517885
RELA	Repression	15517885
SP1	Activation	19781662;9062372
SP1	Unknown	10436859;2251250
TP53	Unknown	17018618

100

Show/Hide all (100)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001676	Process	Long-chain fatty acid metabolic process	IEA
GO:0001937	Process	Negative regulation of endothelial cell proliferation	IEA
GO:0001937	Process	Negative regulation of endothelial cell proliferation	ISS
GO:0002232	Process	Leukocyte chemotaxis involved in inflammatory response	IMP	17114001
GO:0002523	Process	Leukocyte migration involved in inflammatory response	IEA
GO:0002523	Process	Leukocyte migration involved in inflammatory response	ISS
GO:0002540	Process	Leukotriene production involved in inflammatory response	IEA
GO:0004051	Function	Arachidonate 5-lipoxygenase activity	IBA
GO:0004051	Function	Arachidonate 5-lipoxygenase activity	IDA	8615788, 8631361, 19022417, 21233389, 22516296, 23246375, 24282679, 24893149
GO:0004051	Function	Arachidonate 5-lipoxygenase activity	IEA
GO:0004051	Function	Arachidonate 5-lipoxygenase activity	TAS	2829172
GO:0004052	Function	Arachidonate 12(S)-lipoxygenase activity	IEA
GO:0005506	Function	Iron ion binding	IDA	21233389
GO:0005506	Function	Iron ion binding	IEA
GO:0005515	Function	Protein binding	IPI	7929073, 11297527, 16924104, 19022417, 19233132, 24860872, 25416956, 25910212, 26210919, 31515488, 32296183, 32814053
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	HDA	22664934
GO:0005634	Component	Nucleus	IEA
GO:0005635	Component	Nuclear envelope	IBA
GO:0005635	Component	Nuclear envelope	IDA	19233132
GO:0005635	Component	Nuclear envelope	IEA
GO:0005635	Component	Nuclear envelope	TAS
GO:0005641	Component	Nuclear envelope lumen	IDA	8245774
GO:0005641	Component	Nuclear envelope lumen	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA	19233132
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006690	Process	Icosanoid metabolic process	IEA
GO:0006691	Process	Leukotriene metabolic process	IEA
GO:0006691	Process	Leukotriene metabolic process	TAS	3422434
GO:0006950	Process	Response to stress	IEA
GO:0006954	Process	Inflammatory response	IEA
GO:0006959	Process	Humoral immune response	IEA
GO:0006959	Process	Humoral immune response	ISS
GO:0016020	Component	Membrane	IEA
GO:0016363	Component	Nuclear matrix	IDA	19233132
GO:0016363	Component	Nuclear matrix	IEA
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0016491	Function	Oxidoreductase activity	TAS
GO:0016525	Process	Negative regulation of angiogenesis	IEA
GO:0016525	Process	Negative regulation of angiogenesis	ISS
GO:0016701	Function	Oxidoreductase activity, acting on single donors with incorporation of molecular oxygen	TAS
GO:0016702	Function	Oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0019369	Process	Arachidonate metabolic process	IBA
GO:0019370	Process	Leukotriene biosynthetic process	IDA	21233389, 24893149
GO:0019370	Process	Leukotriene biosynthetic process	IEA
GO:0019370	Process	Leukotriene biosynthetic process	IEA
GO:0019372	Process	Lipoxygenase pathway	IBA
GO:0019372	Process	Lipoxygenase pathway	TAS
GO:0030501	Process	Positive regulation of bone mineralization	IEA
GO:0030501	Process	Positive regulation of bone mineralization	ISS
GO:0031965	Component	Nuclear membrane	IDA	8245774
GO:0031965	Component	Nuclear membrane	IEA
GO:0034440	Process	Lipid oxidation	IBA
GO:0034440	Process	Lipid oxidation	IEA
GO:0034774	Component	Secretory granule lumen	TAS
GO:0036336	Process	Dendritic cell migration	IEA
GO:0036336	Process	Dendritic cell migration	ISS
GO:0036403	Function	Arachidonate 8(S)-lipoxygenase activity	IEA
GO:0042593	Process	Glucose homeostasis	IEA
GO:0042593	Process	Glucose homeostasis	ISS
GO:0042759	Process	Long-chain fatty acid biosynthetic process	TAS
GO:0045598	Process	Regulation of fat cell differentiation	IEA
GO:0045598	Process	Regulation of fat cell differentiation	ISS
GO:0046872	Function	Metal ion binding	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	19022417
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0050727	Process	Regulation of inflammatory response	IEA
GO:0050727	Process	Regulation of inflammatory response	IMP	17114001
GO:0050728	Process	Negative regulation of inflammatory response	IDA	21206090
GO:0050796	Process	Regulation of insulin secretion	IEA
GO:0050796	Process	Regulation of insulin secretion	ISS
GO:0051213	Function	Dioxygenase activity	IEA
GO:0061044	Process	Negative regulation of vascular wound healing	IEA
GO:0061044	Process	Negative regulation of vascular wound healing	ISS
GO:0061045	Process	Negative regulation of wound healing	IEA
GO:0061045	Process	Negative regulation of wound healing	ISS
GO:0106014	Process	Regulation of inflammatory response to wounding	IEA
GO:0106014	Process	Regulation of inflammatory response to wounding	ISS
GO:1900015	Process	Regulation of cytokine production involved in inflammatory response	IEA
GO:1900015	Process	Regulation of cytokine production involved in inflammatory response	ISS
GO:1900407	Process	Regulation of cellular response to oxidative stress	IEA
GO:1900407	Process	Regulation of cellular response to oxidative stress	ISS
GO:1901753	Process	Leukotriene A4 biosynthetic process	IDA	24282679
GO:1901753	Process	Leukotriene A4 biosynthetic process	IEA
GO:1901753	Process	Leukotriene A4 biosynthetic process	IMP	31664810
GO:1903426	Process	Regulation of reactive oxygen species biosynthetic process	IMP	26210919
GO:1903573	Process	Negative regulation of response to endoplasmic reticulum stress	IEA
GO:1903573	Process	Negative regulation of response to endoplasmic reticulum stress	ISS
GO:1903671	Process	Negative regulation of sprouting angiogenesis	IEA
GO:1903671	Process	Negative regulation of sprouting angiogenesis	ISS
GO:1904813	Component	Ficolin-1-rich granule lumen	TAS
GO:1904999	Process	Positive regulation of leukocyte adhesion to arterial endothelial cell	IEA
GO:1904999	Process	Positive regulation of leukocyte adhesion to arterial endothelial cell	ISS
GO:2001301	Process	Lipoxin biosynthetic process	IMP	31664810
GO:2001301	Process	Lipoxin biosynthetic process	TAS

MIM	HGNC	e!Ensembl
152390	435	ENSG00000012779

P09917

Protein name

Polyunsaturated fatty acid 5-lipoxygenase (EC 1.13.11.-) (Arachidonate 5-lipoxygenase) (5-LO) (5-lipoxygenase) (EC 1.13.11.34)

Protein function

Catalyzes the oxygenation of arachidonate ((5Z,8Z,11Z,14Z)-eicosatetraenoate) to 5-hydroperoxyeicosatetraenoate (5-HPETE) followed by the dehydration to 5,6- epoxyeicosatetraenoate (Leukotriene A4/LTA4), the first two steps in the biosynthesis o

PDB

3O8Y , 3V92 , 3V98 , 3V99 , 6N2W , 6NCF , 7TTJ , 7TTK , 7TTL

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01477	PLAT	4 → 113	PLAT/LH2 domain	Domain
PF00305	Lipoxygenase	216 → 662	Lipoxygenase	Domain

Sequence

MPSYTVTVATGSQWFAGTDDYIYLSLVGSAGCSEKHLLDKPFYNDFERGAVDSYDVTVDE
ELGEIQLVRIEKRKYWLNDDWYLKYITLKTPHGDYIEFPCYRWITGDVEVVLRDGRAKLA
RDDQIHILKQHRRKELETRQKQYRWMEWNPGFPLSIDAKCHKDLPRDIQFDSEKGVDFVL
NYSKAMENLFINRFMHMFQSSWNDFADFEKIFVKISNTISERVMNHWQEDLMFGYQFLNG
CNPVLIRRCTELPEKLPVTTEMVECSLERQLSLEQEVQQGNIFIVDFELLDGIDANKTDP
CTLQFLAAPICLLYKNLANKIVPIAIQLNQIPGDENPIFLPSDAKYDWLLAKIWVRSSDF
HVHQTITHLLRTHLVSEVFGIAMYRQLPAVHPIFKLLVAHVRFTIAINTKAREQLICECG
LFDKANATGGGGHVQMVQRAMKDLTYASLCFPEAIKARGMESKEDIPYYFYRDDGLLVWE
AIRTFTAEVVDIYYEGDQVVEEDPELQDFVNDVYVYGMRGRKSSGFPKSVKSREQLSEYL
TVVIFTASAQHAAVNFGQYDWCSWIPNAPPTMRAPPPTAKGVVTIEQIVDTLPDRGRSCW
HLGAVWALSQFQENELFLGMYPEEHFIEKPVKEAMARFRKNLEAIVSVIAERNKKKQLPY
YYLSPDRIPNSVAI

Sequence length

674

Interactions

View interactions

	KEGG		Reactome
	Arachidonic acid metabolism Metabolic pathways Efferocytosis Fc epsilon RI signaling pathway Serotonergic synapse Ovarian steroidogenesis Toxoplasmosis		Synthesis of 5-eicosatetraenoic acids Synthesis of Leukotrienes (LT) and Eoxins (EX) Synthesis of Lipoxins (LX) Interleukin-4 and Interleukin-13 signaling Neutrophil degranulation Interleukin-18 signaling Biosynthesis of D-series resolvins Biosynthesis of maresins Biosynthesis of E-series 18(S)-resolvins Biosynthesis of aspirin-triggered D-series resolvins Biosynthesis of E-series 18(R)-resolvins Biosynthesis of DPAn-3-derived protectins and resolvins Biosynthesis of DPAn-3-derived maresins Biosynthesis of DPAn-3-derived 13-series resolvins Biosynthesis of electrophilic ω-3 PUFA oxo-derivatives

Show/Hide Unknown Diseases (8)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Acute myeloid leukemia	Benign	rs150281723	RCV005904554
Asthma, diminished response to antileukotriene treatment in	drug response; risk factor	rs59439148	RCV000015530
Atherosclerosis, susceptibility to	drug response; risk factor	rs59439148	RCV000015531
Breast ductal adenocarcinoma	Uncertain significance	rs869025237	RCV000207073
Gastric cancer	Benign	rs150281723	RCV005904557
Malignant tumor of esophagus	Uncertain significance; Benign	rs758477278, rs150281723	RCV005930879 RCV005904555
Pancreatic adenocarcinoma	Benign	rs150281723	RCV005904556
Squamous cell carcinoma of the head and neck	Uncertain significance	rs758477278	RCV005930878

Show/Hide Text Mining Associations (138)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Acquired Immunodeficiency Syndrome	Inhibit	10572106
Acquired Immunodeficiency Syndrome	Associate	18180307
Adenocarcinoma of Lung	Associate	37164914
Adenoma	Associate	17236225, 20549218
Adenomatous Polyps	Associate	20549218
Anemia Sickle Cell	Associate	18945963
Aortic Aneurysm Abdominal	Stimulate	21078989
Aortic Aneurysm Abdominal	Associate	27927271, 31539405
Aortic Aneurysm Familial Abdominal 1	Associate	21078989
Aortic Valve Stenosis	Associate	22616993
Argininosuccinic Aciduria	Associate	16361798
Arthritis Rheumatoid	Associate	28316377, 38508862
Asthma	Associate	11471199, 16293801, 16415251, 17153879, 18339529, 18583575, 19214143, 23600541, 24059322, 28623130, 30352167, 30678465, 32096311, 37567324, 9062372
Asthma	Inhibit	40650018
Atherosclerosis	Associate	12552108, 14702425, 18842779, 31316498
Brain Edema	Associate	1357659
Brain Neoplasms	Associate	1357659, 19919819, 31390836
Breast Neoplasms	Associate	18087590, 21643005, 31203442, 37965796
Breast Neoplasms	Stimulate	33224971
Bronchitis Chronic	Associate	11003605
Burkitt Lymphoma	Associate	27855198
Carcinogenesis	Associate	18030360, 19919819, 20549218, 28600709
Carcinoma Hepatocellular	Associate	20173757, 20364155
Carcinoma Non Small Cell Lung	Associate	29901268, 37164914
Carcinoma Renal Cell	Associate	32144299, 38090559
Carcinoma Squamous Cell	Associate	37164914
Cardiomyopathy Dilated	Associate	36035223
Cardiovascular Diseases	Associate	11471199, 19130089, 27893808
Carotid Artery Diseases	Associate	18842779, 23067353
Carotid Stenosis	Associate	29383971
Cerebral Infarction	Associate	29041000, 37567324
Cholangiocarcinoma	Stimulate	18507031
Chronic Disease	Associate	32093765
Colonic Diseases	Associate	20549218
Colonic Neoplasms	Associate	18976020
Colonic Neoplasms	Stimulate	36849252
Colonic Polyps	Associate	37756582
Colorectal Neoplasms	Associate	17072961, 18976020, 35444656, 37144561, 37586118, 37654195, 39940328, 40082818
Colorectal Neoplasms	Stimulate	23013454
Coronary Artery Disease	Associate	18369664, 21293878, 23067353, 29067980
COVID 19	Associate	34417262, 36052061, 38171849
COVID 19	Stimulate	36613462
Crohn Disease	Associate	14656710, 16951496, 21187935
Cytomegalovirus Infections	Associate	18180307
Cytomegalovirus Infections	Stimulate	37654195
Developmental Disabilities	Associate	36358993
Diabetes Gestational	Associate	32093765
Diabetes Mellitus	Stimulate	34417262
Diabetes Mellitus Type 2	Associate	24059322, 26378572, 29383971, 32093765
Diabetic Nephropathies	Associate	37038746
Disease	Associate	28566527
Drug Hypersensitivity	Associate	24059322
Drug Related Side Effects and Adverse Reactions	Associate	20860670
Endometrial Neoplasms	Associate	30168128
Glioblastoma	Associate	31390836
Glioma	Associate	19423540, 19919819, 31390836, 32484805
Glomerulonephritis	Associate	10337029
Glomerulonephritis Membranous	Associate	10337029
Heart Diseases	Associate	24059322
Heart Failure	Associate	37073135
Hidradenitis Suppurativa	Associate	32387270
HIV Infections	Inhibit	10572106
HIV Infections	Associate	9710433
Hypertension Pulmonary	Associate	11788406, 24906007
Hypoxia	Stimulate	24906007
Hypoxia Brain	Associate	23148666
Ichthyosis Bullosa of Siemens	Associate	34859100
Immune System Diseases	Associate	25171226
Infections	Stimulate	18180307
Inflammation	Associate	11508440, 12115185, 12552108, 14702425, 20103664, 22282663, 23968978, 24962583, 25721048, 26329759, 26378572, 26621841, 27681120, 28316377, 30292675 View all (10 more)
Inflammation	Stimulate	37164914
Inflammatory Bowel Diseases	Associate	18180307
Intervertebral Disc Degeneration	Associate	38007425
Kidney Diseases	Associate	10337029
Kidney Failure Chronic	Stimulate	16531984
Laurin Sandrow syndrome	Associate	22135214
Leukemia	Associate	23211037, 25193960, 26329759
Leukemia Lymphocytic Chronic B Cell	Associate	40076826, 7556168
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	25193960, 28623130
Leukemia Prolymphocytic B Cell	Associate	19134178
Leukotriene C4 Synthase Deficiency	Associate	38171849
Lung Diseases	Associate	24906007
Lung Neoplasms	Associate	37073135
Lung Neoplasms	Inhibit	37164914
Lymphoma	Associate	19134178
Lymphoma B Cell	Associate	34116165
Lymphoma Mantle Cell	Associate	19134178, 34116165, 40076826
Lymphoma Non Hodgkin	Associate	32484805
Lymphoma Primary Effusion	Associate	24335295
Lymphoma T Cell	Associate	24350867
Macrophage Activation Syndrome	Associate	31894359, 34067705
Melanoma	Associate	15132836
Mesothelioma Malignant	Associate	30941737
Metabolic Diseases	Associate	32093765
Metabolic Syndrome	Associate	29067980
Mitochondrial Diseases	Associate	14656710, 16531984
Multiple Myeloma	Associate	21720561
Multiple Sclerosis	Associate	18366677
Multiple Sclerosis	Stimulate	18366677
Myocardial Infarction	Associate	18842779, 23067353, 27893808, 30678701, 37567324
Myopathy Central Core	Associate	36035208
Neoplasm Metastasis	Associate	15132836, 37164914
Neoplasms	Associate	12163367, 1357659, 15008988, 17218785, 18030360, 18976020, 19919819, 20860670, 22253131, 23013454, 27530979, 31316498, 32096311, 32484805, 34121352 View all (6 more)
Neoplasms	Stimulate	17072961
Nephrotic Syndrome	Associate	10337029
Neurodegenerative Diseases	Associate	24059322, 31316498
Obesity	Associate	24059322, 26378572
Osteoarthritis	Associate	37960823
Osteosarcoma	Associate	1469057, 3164719
Ovarian Neoplasms	Associate	20103664, 22282663
Pancreatic Neoplasms	Associate	12163367, 20860670
Plaque Atherosclerotic	Associate	23351835, 25383745
Pleural Effusion	Associate	15008988
Polyps	Associate	20549218
Post Acute COVID 19 Syndrome	Stimulate	36613462
Precancerous Conditions	Associate	20860670
Prostatic Neoplasms	Associate	15305379, 17218785, 21824498, 23076676, 25540201, 25875826, 9789062
Prostatic Neoplasms Castration Resistant	Associate	25875826
Rectal Neoplasms	Inhibit	23404351
Rectal Neoplasms	Associate	37144561
Respiratory Sounds	Associate	25212745
Sarcoma Kaposi	Associate	24335295
Scleroderma Systemic	Associate	11508440
Status Asthmaticus	Associate	16415251, 1905725
Stomach Neoplasms	Stimulate	34121352
Thyroid Cancer Papillary	Associate	22253131, 39510033
Tuberculosis	Associate	23448388, 37567324
Tuberculosis Meningeal	Associate	37567324
Tuberculosis Multidrug Resistant	Inhibit	37774806
Tuberculosis Pulmonary	Associate	37567324
Urethral Neoplasms	Associate	38255812
Urinary Bladder Neoplasms	Associate	35664354, 38062004
Urticaria	Associate	16361798
Uterine Cervical Dysplasia	Associate	20549218
Uterine Cervical Neoplasms	Associate	33786614, 39224598
Vascular System Injuries	Associate	8879231
Waldenstrom Macroglobulinemia	Associate	33690107
Wounds and Injuries	Associate	28316377

ALOX5 (arachidonate 5-lipoxygenase)