Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	239
Gene name Gene Name - the full gene name approved by the HGNC.	Arachidonate 12-lipoxygenase, 12S type
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	ALOX12
Synonyms (NCBI Gene) Gene synonyms aliases	12-LOX, 12S-LOX, LOG12
Chromosome Chromosome number	17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	17p13.1
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the lipoxygenase family of proteins. The encoded enzyme acts on different polyunsaturated fatty acid substrates to generate bioactive lipid mediators including eicosanoids and lipoxins. The encoded enzyme and its reaction pro

Show/Hide all(15)

miRTarBase ID	miRNA	Experiments	Reference
MIRT437657	hsa-miR-195-5p	Microarray, qRT-PCR	22815788
MIRT438332	hsa-miR-185-5p	Luciferase reporter assay, Western blot	24070899
MIRT438332	hsa-miR-185-5p	Luciferase reporter assay, Western blot	24070899
MIRT1929912	hsa-miR-15a	CLIP-seq
MIRT1929913	hsa-miR-15b	CLIP-seq
MIRT1929914	hsa-miR-16	CLIP-seq
MIRT1929915	hsa-miR-195	CLIP-seq
MIRT1929916	hsa-miR-424	CLIP-seq
MIRT1929917	hsa-miR-4496	CLIP-seq
MIRT1929918	hsa-miR-4524	CLIP-seq
MIRT1929919	hsa-miR-497	CLIP-seq
MIRT1929920	hsa-miR-503	CLIP-seq
MIRT1929921	hsa-miR-646	CLIP-seq
MIRT1929922	hsa-miR-651	CLIP-seq
MIRT1929923	hsa-miR-922	CLIP-seq

Transcription factors

Show/Hide all(6)

Transcription factor	Regulation	Reference
JUN	Unknown	14518567
RUNX1	Unknown	20181616
SP1	Activation	9164849
SP1	Unknown	14518567;16118214
SP3	Activation	9164849
STAT6	Unknown	10657944

Show/Hide all(55)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004052	Function	Arachidonate 12(S)-lipoxygenase activity	IBA	21873635
GO:0004052	Function	Arachidonate 12(S)-lipoxygenase activity	IDA	1851637, 2217179, 2377602, 8319693, 17493578, 18311922, 22984144, 24282679
GO:0005506	Function	Iron ion binding	IEA
GO:0005515	Function	Protein binding	IPI	10727209
GO:0005737	Component	Cytoplasm	IDA	8319693
GO:0005829	Component	Cytosol	IBA	21873635
GO:0005829	Component	Cytosol	IDA	8912711, 15107407
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IBA	21873635
GO:0006629	Process	Lipid metabolic process	IDA	17493578, 18311922, 22984144
GO:0007568	Process	Aging	IEA
GO:0010628	Process	Positive regulation of gene expression	IEA
GO:0010656	Process	Negative regulation of muscle cell apoptotic process	IMP	23578768
GO:0016020	Component	Membrane	IDA	8912711
GO:0016165	Function	Linoleate 13S-lipoxygenase activity	IBA	21873635
GO:0016165	Function	Linoleate 13S-lipoxygenase activity	IDA	8319693
GO:0016702	Function	Oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen	IBA	21873635
GO:0019369	Process	Arachidonic acid metabolic process	IBA	21873635
GO:0019369	Process	Arachidonic acid metabolic process	IDA	1851637, 8319693
GO:0019369	Process	Arachidonic acid metabolic process	ISS
GO:0019372	Process	Lipoxygenase pathway	IBA	21873635
GO:0019372	Process	Lipoxygenase pathway	IDA	8319693
GO:0019372	Process	Lipoxygenase pathway	TAS
GO:0019395	Process	Fatty acid oxidation	IDA	17493578, 18311922, 22984144, 23504711, 24282679, 25036362
GO:0019395	Process	Fatty acid oxidation	IMP	15111312
GO:0033559	Process	Unsaturated fatty acid metabolic process	IDA	23504711, 24282679, 25036362
GO:0034440	Process	Lipid oxidation	IBA	21873635
GO:0042383	Component	Sarcolemma	IBA	21873635
GO:0042383	Component	Sarcolemma	IDA	15107407
GO:0042554	Process	Superoxide anion generation	NAS	15107407
GO:0042759	Process	Long-chain fatty acid biosynthetic process	TAS
GO:0043065	Process	Positive regulation of apoptotic process	IEA
GO:0043280	Process	Positive regulation of cysteine-type endopeptidase activity involved in apoptotic process	IEA
GO:0043536	Process	Positive regulation of blood vessel endothelial cell migration	IEA
GO:0043651	Process	Linoleic acid metabolic process	IBA	21873635
GO:0043651	Process	Linoleic acid metabolic process	IDA	8319693
GO:0043651	Process	Linoleic acid metabolic process	IDA	1851637
GO:0047977	Function	Hepoxilin-epoxide hydrolase activity	ISS
GO:0048661	Process	Positive regulation of smooth muscle cell proliferation	IEA
GO:0050473	Function	Arachidonate 15-lipoxygenase activity	IBA	21873635
GO:0050473	Function	Arachidonate 15-lipoxygenase activity	IDA	17493578, 18311922
GO:0051121	Process	Hepoxilin metabolic process	TAS
GO:0051122	Process	Hepoxilin biosynthetic process	IBA	21873635
GO:0051122	Process	Hepoxilin biosynthetic process	ISS
GO:0051901	Process	Positive regulation of mitochondrial depolarization	IEA
GO:0061436	Process	Establishment of skin barrier	ISS
GO:0070062	Component	Extracellular exosome	HDA	19056867
GO:0071396	Process	Cellular response to lipid	IEA
GO:0090331	Process	Negative regulation of platelet aggregation	ISS
GO:1901751	Process	Leukotriene A4 metabolic process	IDA	8250832
GO:1901751	Process	Leukotriene A4 metabolic process	IDA	1851637
GO:1905956	Process	Positive regulation of endothelial tube morphogenesis	IEA
GO:2001301	Process	Lipoxin biosynthetic process	TAS
GO:2001303	Process	Lipoxin A4 biosynthetic process	IDA	8250832
GO:2001306	Process	Lipoxin B4 biosynthetic process	IDA	8250832

MIM	HGNC	e!Ensembl
152391	429	ENSG00000108839

Protein

UniProt ID

P18054

Protein name

Polyunsaturated fatty acid lipoxygenase ALOX12 (EC 1.13.11.-) (Arachidonate (12S)-lipoxygenase) (12S-LOX) (12S-lipoxygenase) (EC 1.13.11.31) (Arachidonate (15S)-lipoxygenase) (EC 1.13.11.33) (Linoleate (13S)-lipoxygenase) (Lipoxin synthase 12-LO) (EC 3.3.

Protein function

Catalyzes the regio and stereo-specific incorporation of molecular oxygen into free and esterified polyunsaturated fatty acids generating lipid hydroperoxides that can be further reduced to the corresponding hydroxy species (PubMed:17493578, Pub

PDB

3D3L , 8GHB , 8GHC , 8GHD , 8GHE

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01477	PLAT	4 → 108	PLAT/LH2 domain	Domain
PF00305	Lipoxygenase	174 → 649	Lipoxygenase	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in vascular smooth muscle cells. {ECO:0000269|PubMed:23578768}.

Sequence

MGRYRIRVATGAWLFSGSYNRVQLWLVGTRGEAELELQLRPARGEEEEFDHDVAEDLGLL
QFVRLRKHHWLVDDAWFCDRITVQGPGACAEVAFPCYRWVQGEDILSLPEGTARLPGDNA
LDMFQKHREKELKDRQQIYCWATWKEGLPLTIAADRKDDLPPNMRFHEEKRLDFEWTLKA
GALEMALKRVYTLLSSWNCLEDFDQIFWGQKSALAEKVRQCWQDDELFSYQFLNGANPML
LRRSTSLPSRLVLPSGMEELQAQLEKELQNGSLFEADFILLDGIPANVIRGEKQYLAAPL
VMLKMEPNGKLQPMVIQIQPPNPSSPTPTLFLPSDPPLAWLLAKSWVRNSDFQLHEIQYH
LLNTHLVAEVIAVATMRCLPGLHPIFKFLIPHIRYTMEINTRARTQLISDGGIFDKAVST
GGGGHVQLLRRAAAQLTYCSLCPPDDLADRGLLGLPGALYAHDALRLWEIIARYVEGIVH
LFYQRDDIVKGDPELQAWCREITEVGLCQAQDRGFPVSFQSQSQLCHFLTMCVFTCTAQH
AAINQGQLDWYAWVPNAPCTMRMPPPTTKEDVTMATVMGSLPDVRQACLQMAISWHLSRR
QPDMVPLGHHKEKYFSGPKPKAVLNQFRTDLEKLEKEITARNEQLDWPYEYLKPSCIENS
VTI

Sequence length

663

Interactions

View interactions

	KEGG		Reactome
	Arachidonic acid metabolism Metabolic pathways Antifolate resistance Serotonergic synapse Inflammatory mediator regulation of TRP channels		Synthesis of Hepoxilins (HX) and Trioxilins (TrX) Synthesis of Lipoxins (LX) Synthesis of 12-eicosatetraenoic acid derivatives Biosynthesis of DHA-derived SPMs Biosynthesis of DPAn-6 SPMs Biosynthesis of DPAn-3-derived maresins

Show/Hide Causal Diseases (2)

Disease term	Disease name	dbSNP ID	References
Causal
Arthritis	Juvenile arthritis	rs1594890601, rs1594882933, rs184370809, rs776489319, rs1594883470	19565504
Schizophrenia	Schizophrenia	rs13447324, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346 View all (12 more)	20626912

Show/Hide Text Mining Associations (43)

Disease Name	Relationship Type	References
Associations from Text Mining
Adenocarcinoma	Associate	34428433
Adenoma	Associate	23404351, 23778325, 34428433
Arthritis Rheumatoid	Associate	9305751
Asthma	Associate	23321599
Atherosclerosis	Associate	24686056
Breast Neoplasms	Associate	16684880, 33224971
Breast Neoplasms	Stimulate	25339205
Cardiovascular Diseases	Associate	16514435
Colonic Polyps	Associate	37756582
Colorectal Neoplasms	Associate	22237009, 24908683, 34428433, 35833141
Diabetes Mellitus Type 2	Associate	24429578
Diabetes Mellitus Type 2	Stimulate	24955608
Diabetic Nephropathies	Associate	34545296
Down Syndrome	Associate	27293319
Essential Hypertension	Associate	16514435
Fabry Disease	Associate	29772700
Hypertension	Associate	16514435
Hypertrophy	Associate	29772700
Immune System Diseases	Associate	35833141
Immunologic Deficiency Syndromes	Associate	30277667
Inflammation	Associate	22237009, 24686056, 24955608, 9305751
Inflammation	Inhibit	30987861
Leukemia Megakaryoblastic Acute	Associate	22924777
Leukemia Myeloid Acute	Associate	23321599
Muscular Dystrophy Duchenne	Associate	16598376
Neoplasm Metastasis	Associate	35833141
Neoplasms	Associate	22237009, 23321599, 24686056, 34428433, 35833141
Neural Tube Defects	Associate	22924777
Neurodegenerative Diseases	Associate	30987861
Obesity	Associate	20697415
Osteoporosis	Associate	16598376, 30277667
Osteoporotic Fractures	Associate	30277667
Ovarian Neoplasms	Associate	34075060
Pancreatic Neoplasms	Associate	21455317
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	22924777
Primary Ovarian Insufficiency	Associate	36732629
Rectal Neoplasms	Associate	23404351, 24908683
Schizophrenia	Associate	24686056
Squamous Cell Carcinoma of Head and Neck	Associate	29802697
Stress Disorders Post Traumatic	Associate	26372769
Toxoplasmosis	Associate	24686056
Toxoplasmosis Congenital	Associate	24686056
Uterine Cervical Neoplasms	Associate	40197384

ALOX12 (arachidonate 12-lipoxygenase, 12S type)