Gene Gene information from NCBI Gene database.
Entrez ID 23788
Gene name Mitochondrial carrier 2
Gene symbol MTCH2
Synonyms (NCBI Gene)
HSPC032MIMPSLC25A50
Chromosome 11
Chromosome location 11p11.2
Summary This gene encodes a member of the SLC25 family of nuclear-encoded transporters that are localized in the inner mitochondrial membrane. Members of this superfamily are involved in many metabolic pathways and cell functions. Genome-wide association studies
miRNA miRNA information provided by mirtarbase database.
275
miRTarBase ID miRNA Experiments Reference
MIRT029895 hsa-miR-26b-5p Microarray 19088304
MIRT051550 hsa-let-7e-5p CLASH 23622248
MIRT047945 hsa-miR-30c-5p CLASH 23622248
MIRT042361 hsa-miR-484 CLASH 23622248
MIRT038156 hsa-miR-423-5p CLASH 23622248
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
36
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 32296183
GO:0005634 Component Nucleus HDA 21630459
GO:0005739 Component Mitochondrion HTP 34800366
GO:0005739 Component Mitochondrion IBA
GO:0005739 Component Mitochondrion IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
613221 17587 ENSG00000109919
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9Y6C9
Protein name Mitochondrial carrier homolog 2 (Met-induced mitochondrial protein)
Protein function Protein insertase that mediates insertion of transmembrane proteins into the mitochondrial outer membrane (PubMed:36264797). Catalyzes insertion of proteins with alpha-helical transmembrane regions, such as signal-anchored, tail-anchored and mul
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00153 Mito_carr 118 205 Mitochondrial carrier protein Family
Sequence
MADAASQVLLGSGLTILSQPLMYVKVLIQVGYEPLPPTIGRNIFGRQVCQLPGLFSYAQH
IASIDGRRGLFTGLTPRLCSGVLGTVVHGKVLQHYQESDKGEELGPGNVQKEVSSSFDHV
IKETTREMIARSAATLITHPFHVITLRSMVQFIGRESKYCGLCDSIITIYREEGILGFFA
GLVPRLLGDILSLWLCNSLAYLVNT
YALDSGVSTMNEMKSYSQAVTGFFASMLTYPFVLV
SNLMAVNNCGLAGGCPPYSPIYTSWIDCWCMLQKEGNMSRGNSLFFRKVPFGKTYCCDLK
MLI
Sequence length 303
Interactions View interactions