Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
23788
Gene name Gene Name - the full gene name approved by the HGNC.
Mitochondrial carrier 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
MTCH2
Synonyms (NCBI Gene) Gene synonyms aliases
HSPC032, MIMP, SLC25A50
Chromosome Chromosome number
11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
11p11.2
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the SLC25 family of nuclear-encoded transporters that are localized in the inner mitochondrial membrane. Members of this superfamily are involved in many metabolic pathways and cell functions. Genome-wide association studies
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT029895 hsa-miR-26b-5p Microarray 19088304
MIRT051550 hsa-let-7e-5p CLASH 23622248
MIRT047945 hsa-miR-30c-5p CLASH 23622248
MIRT042361 hsa-miR-484 CLASH 23622248
MIRT038156 hsa-miR-423-5p CLASH 23622248
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 32296183
GO:0005634 Component Nucleus HDA 21630459
GO:0005739 Component Mitochondrion HTP 34800366
GO:0005739 Component Mitochondrion IBA
GO:0005739 Component Mitochondrion IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
613221 17587 ENSG00000109919
Protein
UniProt ID Q9Y6C9
Protein name Mitochondrial carrier homolog 2 (Met-induced mitochondrial protein)
Protein function Protein insertase that mediates insertion of transmembrane proteins into the mitochondrial outer membrane (PubMed:36264797). Catalyzes insertion of proteins with alpha-helical transmembrane regions, such as signal-anchored, tail-anchored and mul
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00153 Mito_carr 118 205 Mitochondrial carrier protein Family
Sequence
MADAASQVLLGSGLTILSQPLMYVKVLIQVGYEPLPPTIGRNIFGRQVCQLPGLFSYAQH
IASIDGRRGLFTGLTPRLCSGVLGTVVHGKVLQHYQESDKGEELGPGNVQKEVSSSFDHV
IKETTREMIARSAATLITHPFHVITLRSMVQFIGRESKYCGLCDSIITIYREEGILGFFA
GLVPRLLGDILSLWLCNSLAYLVNT
YALDSGVSTMNEMKSYSQAVTGFFASMLTYPFVLV
SNLMAVNNCGLAGGCPPYSPIYTSWIDCWCMLQKEGNMSRGNSLFFRKVPFGKTYCCDLK
MLI
Sequence length 303
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Diabetes Type 2 diabetes with ophthalmic manifestations (PheCode 250.23) N/A N/A GWAS
Hypertension Hypertension N/A N/A GWAS
Insomnia Insomnia N/A N/A GWAS
Neuroticism Neuroticism N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Abdominal Injuries Associate 31167208
Alzheimer Disease Associate 26919393, 33947463
Cardiovascular Diseases Associate 19910641
Diabetes Mellitus Type 2 Associate 32228543
Feeding and Eating Disorders Associate 23929626
Glioma Associate 40018930
Leukemia Myeloid Associate 34463267
Myofibroma Associate 33830670
Neoplasms Stimulate 33299884
Neoplasms Associate 34437390, 35459861, 40018930