Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	23774
Gene name Gene Name - the full gene name approved by the HGNC.	Bromodomain containing 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	BRD1
Synonyms (NCBI Gene) Gene synonyms aliases	BRL, BRPF1, BRPF2
Chromosome Chromosome number	22
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	22q13.33
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a bromodomain-containing protein that localizes to the nucleus and can interact with DNA and histone tails. The encoded protein is a component of the MOZ/MORF acetyltransferase complex and can stimulate acetylation of histones H3 and H4,

Show/Hide all(100)

miRTarBase ID	miRNA	Experiments	Reference
MIRT021155	hsa-miR-186-5p	Sequencing	20371350
MIRT024192	hsa-miR-221-3p	Sequencing	20371350
MIRT046561	hsa-let-7g-5p	CLASH	23622248
MIRT041191	hsa-miR-497-5p	CLASH	23622248
MIRT040831	hsa-miR-18a-3p	CLASH	23622248
MIRT824152	hsa-miR-1273f	CLIP-seq
MIRT824153	hsa-miR-137	CLIP-seq
MIRT824154	hsa-miR-150	CLIP-seq
MIRT824155	hsa-miR-1972	CLIP-seq
MIRT824156	hsa-miR-2052	CLIP-seq
MIRT824157	hsa-miR-21	CLIP-seq
MIRT824158	hsa-miR-300	CLIP-seq
MIRT824159	hsa-miR-3163	CLIP-seq
MIRT824160	hsa-miR-329	CLIP-seq
MIRT824161	hsa-miR-338-5p	CLIP-seq
MIRT824162	hsa-miR-362-3p	CLIP-seq
MIRT824163	hsa-miR-3713	CLIP-seq
MIRT824164	hsa-miR-381	CLIP-seq
MIRT824165	hsa-miR-3941	CLIP-seq
MIRT824166	hsa-miR-3973	CLIP-seq
MIRT824167	hsa-miR-4255	CLIP-seq
MIRT824168	hsa-miR-4452	CLIP-seq
MIRT824169	hsa-miR-4480	CLIP-seq
MIRT824170	hsa-miR-455-5p	CLIP-seq
MIRT824171	hsa-miR-4666-3p	CLIP-seq
MIRT824172	hsa-miR-4668-3p	CLIP-seq
MIRT824173	hsa-miR-4729	CLIP-seq
MIRT824174	hsa-miR-4789-5p	CLIP-seq
MIRT824175	hsa-miR-520g	CLIP-seq
MIRT824176	hsa-miR-520h	CLIP-seq
MIRT824177	hsa-miR-548k	CLIP-seq
MIRT824178	hsa-miR-550a	CLIP-seq
MIRT824179	hsa-miR-561	CLIP-seq
MIRT824180	hsa-miR-568	CLIP-seq
MIRT824181	hsa-miR-586	CLIP-seq
MIRT824182	hsa-miR-590-5p	CLIP-seq
MIRT824183	hsa-miR-603	CLIP-seq
MIRT824184	hsa-miR-767-3p	CLIP-seq
MIRT824155	hsa-miR-1972	CLIP-seq
MIRT824158	hsa-miR-300	CLIP-seq
MIRT824160	hsa-miR-329	CLIP-seq
MIRT824162	hsa-miR-362-3p	CLIP-seq
MIRT824164	hsa-miR-381	CLIP-seq
MIRT824165	hsa-miR-3941	CLIP-seq
MIRT824166	hsa-miR-3973	CLIP-seq
MIRT824171	hsa-miR-4666-3p	CLIP-seq
MIRT824173	hsa-miR-4729	CLIP-seq
MIRT824174	hsa-miR-4789-5p	CLIP-seq
MIRT824175	hsa-miR-520g	CLIP-seq
MIRT824176	hsa-miR-520h	CLIP-seq
MIRT824177	hsa-miR-548k	CLIP-seq
MIRT824181	hsa-miR-586	CLIP-seq
MIRT824183	hsa-miR-603	CLIP-seq
MIRT2182303	hsa-miR-122	CLIP-seq
MIRT824154	hsa-miR-150	CLIP-seq
MIRT824157	hsa-miR-21	CLIP-seq
MIRT824159	hsa-miR-3163	CLIP-seq
MIRT2182304	hsa-miR-340	CLIP-seq
MIRT2182305	hsa-miR-3659	CLIP-seq
MIRT2182306	hsa-miR-3667-5p	CLIP-seq
MIRT824166	hsa-miR-3973	CLIP-seq
MIRT2182307	hsa-miR-4289	CLIP-seq
MIRT824169	hsa-miR-4480	CLIP-seq
MIRT824172	hsa-miR-4668-3p	CLIP-seq
MIRT824175	hsa-miR-520g	CLIP-seq
MIRT824176	hsa-miR-520h	CLIP-seq
MIRT824177	hsa-miR-548k	CLIP-seq
MIRT824182	hsa-miR-590-5p	CLIP-seq
MIRT824184	hsa-miR-767-3p	CLIP-seq
MIRT824152	hsa-miR-1273f	CLIP-seq
MIRT2486001	hsa-miR-3124-3p	CLIP-seq
MIRT2486002	hsa-miR-3692	CLIP-seq
MIRT2486003	hsa-miR-384	CLIP-seq
MIRT824166	hsa-miR-3973	CLIP-seq
MIRT2486004	hsa-miR-4643	CLIP-seq
MIRT2486005	hsa-miR-466	CLIP-seq
MIRT2486006	hsa-miR-4672	CLIP-seq
MIRT2486007	hsa-miR-4698	CLIP-seq
MIRT2486008	hsa-miR-4713-5p	CLIP-seq
MIRT2486009	hsa-miR-4789-3p	CLIP-seq
MIRT824177	hsa-miR-548k	CLIP-seq
MIRT2486010	hsa-miR-616	CLIP-seq
MIRT824152	hsa-miR-1273f	CLIP-seq
MIRT2676034	hsa-miR-1587	CLIP-seq
MIRT2486001	hsa-miR-3124-3p	CLIP-seq
MIRT2486002	hsa-miR-3692	CLIP-seq
MIRT2676035	hsa-miR-378g	CLIP-seq
MIRT824166	hsa-miR-3973	CLIP-seq
MIRT2676036	hsa-miR-4286	CLIP-seq
MIRT2676037	hsa-miR-4492	CLIP-seq
MIRT2676038	hsa-miR-4498	CLIP-seq
MIRT2676039	hsa-miR-4656	CLIP-seq
MIRT2486006	hsa-miR-4672	CLIP-seq
MIRT2676040	hsa-miR-4675	CLIP-seq
MIRT2486007	hsa-miR-4698	CLIP-seq
MIRT2486008	hsa-miR-4713-5p	CLIP-seq
MIRT2676041	hsa-miR-4741	CLIP-seq
MIRT2676042	hsa-miR-521	CLIP-seq
MIRT824177	hsa-miR-548k	CLIP-seq
MIRT2676043	hsa-miR-762	CLIP-seq

Show/Hide all(36)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	27142060, 32296183, 33961781
GO:0005634	Component	Nucleus	IDA	10602503, 21880731, 25593309
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	IMP	21753189
GO:0005634	Component	Nucleus	ISS
GO:0005634	Component	Nucleus	TAS	10602503
GO:0005694	Component	Chromosome	IEA
GO:0006325	Process	Chromatin organization	IEA
GO:0006338	Process	Chromatin remodeling	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	ISS
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0008270	Function	Zinc ion binding	IEA
GO:0016607	Component	Nuclear speck	IDA
GO:0030425	Component	Dendrite	IEA
GO:0035902	Process	Response to immobilization stress	IEA
GO:0036408	Function	Histone H3K14 acetyltransferase activity	IDA	16387653
GO:0036409	Component	Histone H3-K14 acetyltransferase complex	IDA	21753189
GO:0036409	Component	Histone H3-K14 acetyltransferase complex	IEA
GO:0043204	Component	Perikaryon	IEA
GO:0043249	Process	Erythrocyte maturation	IEA
GO:0043995	Function	Histone H4K5 acetyltransferase activity	IDA	16387653
GO:0043996	Function	Histone H4K8 acetyltransferase activity	IDA	16387653
GO:0043997	Function	Histone H4K12 acetyltransferase activity	IDA	16387653
GO:0045648	Process	Positive regulation of erythrocyte differentiation	IEA
GO:0045648	Process	Positive regulation of erythrocyte differentiation	ISS
GO:0046872	Function	Metal ion binding	IEA
GO:0050793	Process	Regulation of developmental process	NAS	16387653
GO:0051602	Process	Response to electrical stimulus	IEA
GO:0070776	Component	MOZ/MORF histone acetyltransferase complex	IBA
GO:0070776	Component	MOZ/MORF histone acetyltransferase complex	IDA	16387653
GO:0070776	Component	MOZ/MORF histone acetyltransferase complex	IEA
GO:0070776	Component	MOZ/MORF histone acetyltransferase complex	ISS
GO:0140063	Function	Unmodified histone reader activity	IDA	21880731
GO:0140566	Function	Histone reader activity	IEA
GO:0140566	Function	Histone reader activity	ISS
GO:1903706	Process	Regulation of hemopoiesis	NAS	16387653

MIM	HGNC	e!Ensembl
604589	1102	ENSG00000100425

Protein

UniProt ID

O95696

Protein name

Bromodomain-containing protein 1 (BR140-like protein) (Bromodomain and PHD finger-containing protein 2)

Protein function

Scaffold subunit of various histone acetyltransferase (HAT) complexes, such as the MOZ/MORF and HBO1 complexes, that acts as a regulator of hematopoiesis (PubMed:16387653, PubMed:21753189, PubMed:21880731). Plays a key role in HBO1 complex by di

PDB

2KU3 , 2L43 , 2LQ6 , 3LYI , 3RCW , 4Z02 , 5AME , 5AMF , 5FG6 , 5GK9 , 5N49 , 5PNX , 5PNY , 5PNZ , 5PO0 , 5PO1 , 5PO2 , 5PO3 , 5PO4 , 5PO5 , 5PO6 , 5PO7 , 5PO8 , 5PO9 , 5POA , 5POB , 5POC , 5POD , 5POE , 5POF , 5POG , 5POH , 5POI , 5POJ , 5POK , 5POL , 5POM , 5PON , 5POO , 5POP , 5POQ , 5POR , 5POS , 5POT , 5POU , 5POV , 5POW , 5POX , 5POY , 5POZ , 5PP0

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF10513	EPL1	47 → 196	Enhancer of polycomb-like	Family
PF13831	PHD_2	228 → 262		Family
PF13832	zf-HC5HC2H_2	269 → 388		Domain
PF00439	Bromodomain	571 → 654	Bromodomain	Domain
PF00855	PWWP	927 → 1044	PWWP domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in testis. {ECO:0000269|PubMed:10602503}.

Sequence

MRRKGRCHRGSAARHPSSPCSVKHSPTRETLTYAQAQRMVEIEIEGRLHRISIFDPLEII
LEDDLTAQEMSECNSNKENSERPPVCLRTKRHKNNRVKKKNEALPSAHGTPASASALPEP
KVRIVEYSPPSAPRRPPVYYKFIEKSAEELDNEVEYDMDEEDYAWLEIVNEKRKGDCVPA
VSQSMFEFLMDRFEKESHCENQKQGEQQSLIDEDAVCCICMDGECQNSNVILFCDMCNLA
VHQECYGVPYIPEGQWLCRHCLQSRARPADCVLCPNKGGAFKKTDDDRWGHVVCALWIPE
VGFANTVFIEPIDGVRNIPPARWKLTCYLCKQKGVGACIQCHKANCYTAFHVTCAQKAGL
YMKMEPVKELTGGGTTFSVRKTAYCDVHTPPGCTRRPLNIYGDVEMKNGVCRKESSVKTV
RSTSKVRKKAKKAKKALAEPCAVLPTVCAPYIPPQRLNRIANQVAIQRKKQFVERAHSYW
LLKRLSRNGAPLLRRLQSSLQSQRSSQQRENDEEMKAAKEKLKYWQRLRHDLERARLLIE
LLRKREKLKREQVKVEQVAMELRLTPLTVLLRSVLDQLQDKDPARIFAQPVSLKEVPDYL
DHIKHPMDFATMRKRLEAQGYKNLHEFEEDFDLIIDNCMKYNARDTVFYRAAVRLRDQGG
VVLRQARREVDSIGLEEASGMHLPERPAAAPRRPFSWEDVDRLLDPANRAHLGLEEQLRE
LLDMLDLTCAMKSSGSRSKRAKLLKKEIALLRNKLSQQHSQPLPTGPGLEGFEEDGAALG
PEAGEEVLPRLETLLQPRKRSRSTCGDSEVEEESPGKRLDAGLTNGFGGARSEQEPGGGL
GRKATPRRRCASESSISSSNSPLCDSSFNAPKCGRGKPALVRRHTLEDRSELISCIENGN
YAKAARIAAEVGQSSMWISTDAAASVLEPLKVVWAKCSGYPSYPALIIDPKMPRVPGHHN
GVTIPAPPLDVLKIGEHMQTKSDEKLFLVLFFDNKRSWQWLPKSKMVPLGIDETIDKLKM
MEGRNSSIRKAVRIAFDRAMNHLSRVHGEPTSDLSDID

Sequence length

1058

Interactions

View interactions

	Reactome
			HATs acetylate histones Regulation of TP53 Activity through Acetylation

Show/Hide Unknown Diseases (2)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	BRD1 expression levels in NPC tissues were also significantly higher than in non-NPC tissues by RNA-Seq (p = 0.0079)	31073033	CBGDA
Schizophrenia	Schizophrenia	N/A	N/A	GWAS

Show/Hide Text Mining Associations (14)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Arthritis Rheumatoid	Associate	30042400
Bipolar Disorder	Associate	27142060, 28095495
Breast Neoplasms	Associate	19644018, 31015424
Carcinoma Hepatocellular	Associate	29453316
Cleft Palate	Associate	32241273
Colorectal Neoplasms	Associate	34482774
Ependymoma	Associate	25909290
Mental Disorders	Associate	27142060, 35941107
Mitochondrial Diseases	Associate	35941107
Osteoporosis	Associate	36937804
Papilloma Choroid Plexus	Associate	36963804
Pulmonary Disease Chronic Obstructive	Associate	36937804
Schizophrenia	Associate	27142060, 28095495
Telomeric 22q13 Monosomy Syndrome	Associate	33407854, 35328081, 38002941

BRD1 (bromodomain containing 1)