FLRT3 (fibronectin leucine rich transmembrane protein 3)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID 23767
Gene name Fibronectin leucine rich transmembrane protein 3
Gene symbol FLRT3
Synonyms (NCBI Gene)
HH21
Chromosome 20
Chromosome location 20p12.1
Summary This gene encodes a member of the fibronectin leucine rich transmembrane protein (FLRT) family. FLRTs may function in cell adhesion and/or receptor signalling. Their protein structures resemble small leucine-rich proteoglycans found in the extracellular m
miRNA miRNA information provided by mirtarbase database.
5
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (5)
miRTarBase ID miRNA Experiments Reference
MIRT1996037 hsa-miR-323b-3p CLIP-seq
MIRT1996038 hsa-miR-450b-5p CLIP-seq
MIRT1996039 hsa-miR-4708-3p CLIP-seq
MIRT1996040 hsa-miR-3065-5p CLIP-seq
MIRT1996041 hsa-miR-3647-3p CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
63
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (63)
GO ID Ontology Definition Evidence Reference
GO:0003345 Process Proepicardium cell migration involved in pericardium morphogenesis IEA
GO:0003345 Process Proepicardium cell migration involved in pericardium morphogenesis ISS
GO:0005104 Function Fibroblast growth factor receptor binding IEA
GO:0005515 Function Protein binding IPI 26235030, 26960425
GO:0005576 Component Extracellular region IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
604808 3762 ENSG00000125848
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9NZU0
Protein name Leucine-rich repeat transmembrane protein FLRT3 (Fibronectin-like domain-containing leucine-rich transmembrane protein 3)
Protein function Functions in cell-cell adhesion, cell migration and axon guidance, exerting an attractive or repulsive role depending on its interaction partners. Plays a role in the spatial organization of brain neurons. Plays a role in vascular development in
PDB 5CMN , 5CMP , 6JBU
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13855 LRR_8 175 → 237 Leucine rich repeat Repeat
PF13855 LRR_8 247 → 306 Leucine rich repeat Repeat
Tissue specificity TISSUE SPECIFICITY: Expressed in kidney, brain, pancreas, skeletal muscle, lung, liver, placenta, and heart. {ECO:0000269|PubMed:10644439}.
Sequence 
MISAAWSIFLIGTKIGLFLQVAPLSVMAKSCPSVCRCDAGFIYCNDRFLTSIPTGIPEDA
TTLYLQNNQINNAGIPSDLKNLLKVERIYLYHNSLDEFPTNLPKYVKELHLQENNIRTIT
YDSLSKIPYLEELHLDDNSVSAVSIEEGAFRDSNYLRLLFLSRNHLSTIPWGLPRTIEEL
RLDDNRISTISSPSLQGLTSLKRLVLDGNLLNNHGLGDKVFFNLVNLTELSLVRNSLTAA
PVNLPGTNLRKLYLQDNHINRVPPNAFSYLRQLYRLDMSNNNLSNLPQGIFDDLDNITQL
ILRNNPWYCGCKMKWVRDWLQSLPVKVNVRGLMCQAPEKVRGMAIKDLNAELFDCKDSGI
VSTIQITTAIPNTVYPAQGQWPAPVTKQPDIKNPKLTKDHQTTGSPSRKTITITVKSVTS
DTIHISWKLALPMTALRLSWLKLGHSPAFGSITETIVTGERSEYLVTALEPDSPYKVCMV
PMETSNLYLFDETPVCIETETAPLRMYNPTTTLNREQEKEPYKNPNLPLAAIIGGAVALV
TIALLALVCWYVHRNGSLFSRNCAYSKGRRRKDDYAEAGTKKDNSILEIRETSFQMLPIS
NEPISKEEFVIHTIFPPNGMNLYKNNHSESSSNRSYRDSGIPDSDHSHS
Sequence length 649
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  Reactome
    Downstream signaling of activated FGFR1
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
17
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Causal Diseases (1)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Hypogonadotropic hypogonadism 21 with or without anosmia Pathogenic rs398124654 RCV000043605
Show/Hide Unknown Diseases (6)
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Disorder of sexual differentiation Uncertain significance rs1568559330 RCV001564037
FLRT3-related disorder Likely benign; Conflicting classifications of pathogenicity rs148251977, rs202177618, rs752289875, rs754866739 RCV003961286
RCV003900995
RCV003946591
RCV003899621
High myopia Uncertain significance rs1345083050 RCV000785716
HYPOGONADOTROPIC HYPOGONADISM 21 WITH ANOSMIA, SUSCEPTIBILITY TO risk factor rs398124651, rs398124652, rs398124653 RCV000043602
RCV000043603
RCV000043604
Show/Hide Text Mining Associations (12)
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Behcet Syndrome Inhibit 39191728
Bipolar Disorder Associate 39191728
Carcinogenesis Inhibit 35560224
Carcinoma Renal Cell Associate 37689589
Carcinoma Squamous Cell Associate 35676660
Colorectal Neoplasms Associate 35560224
Hypogonadism Associate 37108593
Idiopathic Hypogonadotropic Hypogonadism Associate 36700485
Kallmann Syndrome Associate 37108593
Neoplasm Metastasis Inhibit 35560224