FLRT3 (fibronectin leucine rich transmembrane protein 3)

Gene
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
23767
Gene name Gene Name - the full gene name approved by the HGNC.
Fibronectin leucine rich transmembrane protein 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
FLRT3
Synonyms (NCBI Gene) Gene synonyms aliases
HH21
Chromosome Chromosome number
20
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
20p12.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the fibronectin leucine rich transmembrane protein (FLRT) family. FLRTs may function in cell adhesion and/or receptor signalling. Their protein structures resemble small leucine-rich proteoglycans found in the extracellular m
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(5)
miRTarBase ID miRNA Experiments Reference
MIRT1996037 hsa-miR-323b-3p CLIP-seq
MIRT1996038 hsa-miR-450b-5p CLIP-seq
MIRT1996039 hsa-miR-4708-3p CLIP-seq
MIRT1996040 hsa-miR-3065-5p CLIP-seq
MIRT1996041 hsa-miR-3647-3p CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(63)
GO ID Ontology Definition Evidence Reference
GO:0003345 Process Proepicardium cell migration involved in pericardium morphogenesis IEA
GO:0003345 Process Proepicardium cell migration involved in pericardium morphogenesis ISS
GO:0005104 Function Fibroblast growth factor receptor binding IEA
GO:0005515 Function Protein binding IPI 26235030, 26960425
GO:0005576 Component Extracellular region IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
604808 3762 ENSG00000125848
Protein
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Q9NZU0
Protein name Leucine-rich repeat transmembrane protein FLRT3 (Fibronectin-like domain-containing leucine-rich transmembrane protein 3)
Protein function Functions in cell-cell adhesion, cell migration and axon guidance, exerting an attractive or repulsive role depending on its interaction partners. Plays a role in the spatial organization of brain neurons. Plays a role in vascular development in
PDB 5CMN , 5CMP , 6JBU
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13855 LRR_8 175 → 237 Leucine rich repeat Repeat
PF13855 LRR_8 247 → 306 Leucine rich repeat Repeat
Tissue specificity TISSUE SPECIFICITY: Expressed in kidney, brain, pancreas, skeletal muscle, lung, liver, placenta, and heart. {ECO:0000269|PubMed:10644439}.
Sequence 
MISAAWSIFLIGTKIGLFLQVAPLSVMAKSCPSVCRCDAGFIYCNDRFLTSIPTGIPEDA
TTLYLQNNQINNAGIPSDLKNLLKVERIYLYHNSLDEFPTNLPKYVKELHLQENNIRTIT
YDSLSKIPYLEELHLDDNSVSAVSIEEGAFRDSNYLRLLFLSRNHLSTIPWGLPRTIEEL
RLDDNRISTISSPSLQGLTSLKRLVLDGNLLNNHGLGDKVFFNLVNLTELSLVRNSLTAA
PVNLPGTNLRKLYLQDNHINRVPPNAFSYLRQLYRLDMSNNNLSNLPQGIFDDLDNITQL
ILRNNPWYCGCKMKWVRDWLQSLPVKVNVRGLMCQAPEKVRGMAIKDLNAELFDCKDSGI
VSTIQITTAIPNTVYPAQGQWPAPVTKQPDIKNPKLTKDHQTTGSPSRKTITITVKSVTS
DTIHISWKLALPMTALRLSWLKLGHSPAFGSITETIVTGERSEYLVTALEPDSPYKVCMV
PMETSNLYLFDETPVCIETETAPLRMYNPTTTLNREQEKEPYKNPNLPLAAIIGGAVALV
TIALLALVCWYVHRNGSLFSRNCAYSKGRRRKDDYAEAGTKKDNSILEIRETSFQMLPIS
NEPISKEEFVIHTIFPPNGMNLYKNNHSESSSNRSYRDSGIPDSDHSHS
Sequence length 649
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  Reactome
    Downstream signaling of activated FGFR1
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Causal Diseases (1)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Hypogonadotropic Hypogonadism With Or Without Anosmia hypogonadotropic hypogonadism 21 with or without anosmia rs398124654 N/A
Show/Hide Unknown Diseases (1)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Kallmann Syndrome Kallmann syndrome N/A N/A GenCC
Show/Hide Text Mining Associations (12)
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Behcet Syndrome Inhibit 39191728
Bipolar Disorder Associate 39191728
Carcinogenesis Inhibit 35560224
Carcinoma Renal Cell Associate 37689589
Carcinoma Squamous Cell Associate 35676660
Colorectal Neoplasms Associate 35560224
Hypogonadism Associate 37108593
Idiopathic Hypogonadotropic Hypogonadism Associate 36700485
Kallmann Syndrome Associate 37108593
Neoplasm Metastasis Inhibit 35560224