Gene Gene information from NCBI Gene database.
Entrez ID 23764
Gene name MAF bZIP transcription factor F
Gene symbol MAFF
Synonyms (NCBI Gene)
U-MAFhMafF
Chromosome 22
Chromosome location 22q13.1
Summary The protein encoded by this gene is a basic leucine zipper (bZIP) transcription factor that lacks a transactivation domain. It is known to bind the US-2 DNA element in the promoter of the oxytocin receptor (OTR) gene and most likely heterodimerizes with o
miRNA miRNA information provided by mirtarbase database.
128
miRTarBase ID miRNA Experiments Reference
MIRT018523 hsa-miR-335-5p Microarray 18185580
MIRT706868 hsa-miR-4781-3p HITS-CLIP 21572407
MIRT706867 hsa-miR-6499-3p HITS-CLIP 21572407
MIRT706866 hsa-miR-31-3p HITS-CLIP 21572407
MIRT706865 hsa-miR-3135b HITS-CLIP 21572407
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
27
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II NAS 27052415, 33897412
GO:0000785 Component Chromatin ISA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific ISA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
604877 6780 ENSG00000185022
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9ULX9
Protein name Transcription factor MafF (U-Maf) (V-maf musculoaponeurotic fibrosarcoma oncogene homolog F)
Protein function Since they lack a putative transactivation domain, the small Mafs behave as transcriptional repressors when they dimerize among themselves (PubMed:8932385). However, they seem to serve as transcriptional activators by dimerizing with other (usua
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF03131 bZIP_Maf 24 115 bZIP Maf transcription factor Coiled-coil
Tissue specificity TISSUE SPECIFICITY: Expressed in the term myometrium and kidney.
Sequence
MSVDPLSSKALKIKRELSENTPHLSDEALMGLSVRELNRHLRGLSAEEVTRLKQRRRTLK
NRGYAASCRVKRVCQKEELQKQKSELEREVDKLARENAAMRLELDALRGKCEALQ
GFARS
VAAARGPATLVAPASVITIVKSTPGSGSGPAHGPDPAHGPASCS
Sequence length 164
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Factors involved in megakaryocyte development and platelet production