Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
23764
Gene name Gene Name - the full gene name approved by the HGNC.
MAF bZIP transcription factor F
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
MAFF
Synonyms (NCBI Gene) Gene synonyms aliases
U-MAF, hMafF
Chromosome Chromosome number
22
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
22q13.1
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a basic leucine zipper (bZIP) transcription factor that lacks a transactivation domain. It is known to bind the US-2 DNA element in the promoter of the oxytocin receptor (OTR) gene and most likely heterodimerizes with o
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT018523 hsa-miR-335-5p Microarray 18185580
MIRT706868 hsa-miR-4781-3p HITS-CLIP 21572407
MIRT706867 hsa-miR-6499-3p HITS-CLIP 21572407
MIRT706866 hsa-miR-31-3p HITS-CLIP 21572407
MIRT706865 hsa-miR-3135b HITS-CLIP 21572407
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA 21873635
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA 21873635
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific ISA
GO:0001228 Function DNA-binding transcription activator activity, RNA polymerase II-specific IDA 12490281
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
604877 6780 ENSG00000185022
Protein
UniProt ID Q9ULX9
Protein name Transcription factor MafF (U-Maf) (V-maf musculoaponeurotic fibrosarcoma oncogene homolog F)
Protein function Since they lack a putative transactivation domain, the small Mafs behave as transcriptional repressors when they dimerize among themselves (PubMed:8932385). However, they seem to serve as transcriptional activators by dimerizing with other (usua
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF03131 bZIP_Maf 24 115 bZIP Maf transcription factor Coiled-coil
Tissue specificity TISSUE SPECIFICITY: Expressed in the term myometrium and kidney.
Sequence
MSVDPLSSKALKIKRELSENTPHLSDEALMGLSVRELNRHLRGLSAEEVTRLKQRRRTLK
NRGYAASCRVKRVCQKEELQKQKSELEREVDKLARENAAMRLELDALRGKCEALQ
GFARS
VAAARGPATLVAPASVITIVKSTPGSGSGPAHGPDPAHGPASCS
Sequence length 164
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Factors involved in megakaryocyte development and platelet production
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Arthritis Juvenile arthritis rs1594890601, rs1594882933, rs184370809, rs776489319, rs1594883470 19565504
Unknown
Disease term Disease name Evidence References Source
Diabetes Diabetes GWAS
Pelvic Organ Prolapse Pelvic Organ Prolapse GWAS
Metabolic Syndrome Metabolic Syndrome GWAS
Associations from Text Mining
Disease Name Relationship Type References
Breast Neoplasms Associate 34151731
Carcinoma Hepatocellular Associate 29757260
Carcinoma Hepatocellular Inhibit 31969212
COVID 19 Associate 37283761
Glomerulonephritis IGA Associate 28713898
Hepatitis B Associate 33980595
Hypertension Pregnancy Induced Associate 38006650
Hypertensive Nephropathy Associate 28713898
Infections Associate 33980595
Leukemia Associate 28984203