SDF2L1 (stromal cell derived factor 2 like 1)

Gene

• Entrez ID: 23753
• Gene name: Stromal cell derived factor 2 like 1
• Gene symbol: SDF2L1
• Synonyms (NCBI Gene): -
• Chromosome: 22
• Chromosome location: 22q11.21

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT018061	hsa-miR-335-5p	Microarray	18185580
MIRT022774	hsa-miR-124-3p	Microarray	18668037
MIRT047950	hsa-miR-30c-5p	CLASH	23622248
MIRT1331686	hsa-miR-1224-3p	CLIP-seq
MIRT1331687	hsa-miR-1224-5p	CLIP-seq
MIRT1331688	hsa-miR-124	CLIP-seq
MIRT1331689	hsa-miR-1283	CLIP-seq
MIRT1331690	hsa-miR-1291	CLIP-seq
MIRT1331691	hsa-miR-3158-5p	CLIP-seq
MIRT1331692	hsa-miR-3166	CLIP-seq
MIRT1331693	hsa-miR-3173-5p	CLIP-seq
MIRT1331694	hsa-miR-328	CLIP-seq
MIRT1331695	hsa-miR-34b	CLIP-seq
MIRT1331696	hsa-miR-3677-5p	CLIP-seq
MIRT1331697	hsa-miR-3915	CLIP-seq
MIRT1331698	hsa-miR-4480	CLIP-seq
MIRT1331699	hsa-miR-4689	CLIP-seq
MIRT1331700	hsa-miR-4715-3p	CLIP-seq
MIRT1331701	hsa-miR-4719	CLIP-seq
MIRT1331702	hsa-miR-4722-3p	CLIP-seq
MIRT1331703	hsa-miR-4727-5p	CLIP-seq
MIRT1331704	hsa-miR-4751	CLIP-seq
MIRT1331705	hsa-miR-4758-3p	CLIP-seq
MIRT1331706	hsa-miR-4769-3p	CLIP-seq
MIRT1331707	hsa-miR-4771	CLIP-seq
MIRT1331708	hsa-miR-506	CLIP-seq
MIRT1331709	hsa-miR-543	CLIP-seq
MIRT1331710	hsa-miR-548an	CLIP-seq
MIRT1331711	hsa-miR-593	CLIP-seq
MIRT1331712	hsa-miR-663b	CLIP-seq
MIRT1331700	hsa-miR-4715-3p	CLIP-seq
MIRT1331687	hsa-miR-1224-5p	CLIP-seq
MIRT1331688	hsa-miR-124	CLIP-seq
MIRT1331689	hsa-miR-1283	CLIP-seq
MIRT1331695	hsa-miR-34b	CLIP-seq
MIRT1331697	hsa-miR-3915	CLIP-seq
MIRT1331699	hsa-miR-4689	CLIP-seq
MIRT1331701	hsa-miR-4719	CLIP-seq
MIRT1331704	hsa-miR-4751	CLIP-seq
MIRT1331708	hsa-miR-506	CLIP-seq
MIRT1331710	hsa-miR-548an	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004169	Function	Dolichyl-phosphate-mannose-protein mannosyltransferase activity	IBA	21873635
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005783	Component	Endoplasmic reticulum	IDA	28597544
GO:0005788	Component	Endoplasmic reticulum lumen	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IBA	21873635
GO:0034663	Component	Endoplasmic reticulum chaperone complex	IEA
GO:0035269	Process	Protein O-linked mannosylation	IBA	21873635
GO:0042981	Process	Regulation of apoptotic process	IEA
GO:0051085	Process	Chaperone cofactor-dependent protein refolding	IMP	28597544
GO:0051087	Function	Chaperone binding	IEA
GO:0051117	Function	ATPase binding	IEA
GO:0051787	Function	Misfolded protein binding	IDA	28597544
GO:0071712	Process	ER-associated misfolded protein catabolic process	IEA
GO:0101031	Component	Chaperone complex	IPI	28597544

Other IDs

• MIM: 607551
• HGNC: 10676
• e!Ensembl: ENSG00000128228

Protein

• UniProt ID: Q9HCN8
• Protein name: Stromal cell-derived factor 2-like protein 1 (SDF2-like protein 1) (PWP1-interacting protein 8)
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02815	MIR	43 → 177	MIR domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Ubiquitously expressed with high expression in testis, moderate expression in the pancreas, spleen, prostate, small intestine and colon. Very low expression is seen in brain and skeletal muscle. {ECO:0000269|PubMed:11162531}.
• Sequence:

  MWSAGRGGAAWPVLLGLLLALLVPGGGAAKTGAELVTCGSVLKLLNTHHRVRLHSHDIKY
  GSGSGQQSVTGVEASDDANSYWRIRGGSEGGCPRGSPVRCGQAVRLTHVLTGKNLHTHHF
  PSPLSNNQEVSAFGEDGEGDDLDLWTVRCSGQHWEREAAVRFQHVGTSVFLSVTGEQYGS
  PIRGQHEVHGMPSANTHNTWKAMEGIFIKPSVEPSAGHDEL

• Sequence length: 221

Associated diseases

Causal
Disease term	Disease name	dbSNP ID	References
Prostate cancer	Malignant neoplasm of prostate	rs121909139, rs121909140, rs121909141, rs121909142, rs121909143, rs606231169, rs606231170, rs137852584, rs137852578, rs137852580, rs137852581, rs137852582	17013881
Rheumatoid arthritis	Rheumatoid Arthritis	rs587776843	30891314

Unknown
Disease term	Disease name	Evidence	References	Source
Atrial Fibrillation	Atrial Fibrillation			GWAS

Associations from Text Mining
Disease Name	Relationship Type	References
Breast Neoplasms	Associate	19513569
Nasopharyngeal Carcinoma	Associate	33134371
Neoplasms	Inhibit	33134371