Gene Gene information from NCBI Gene database.
Entrez ID 23704
Gene name Potassium voltage-gated channel subfamily E regulatory subunit 4
Gene symbol KCNE4
Synonyms (NCBI Gene)
MIRP3
Chromosome 2
Chromosome location 2q36.1
Summary Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuro
miRNA miRNA information provided by mirtarbase database.
498
miRTarBase ID miRNA Experiments Reference
MIRT681728 hsa-miR-4778-5p HITS-CLIP 23706177
MIRT681727 hsa-miR-939-3p HITS-CLIP 23706177
MIRT681726 hsa-miR-1285-3p HITS-CLIP 23706177
MIRT681725 hsa-miR-3187-5p HITS-CLIP 23706177
MIRT681724 hsa-miR-5189-5p HITS-CLIP 23706177
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
24
GO ID Ontology Definition Evidence Reference
GO:0005249 Function Voltage-gated potassium channel activity IEA
GO:0005251 Function Delayed rectifier potassium channel activity IBA
GO:0005267 Function Potassium channel activity IEA
GO:0005515 Function Protein binding IPI 19687231, 20533308, 32296183
GO:0006811 Process Monoatomic ion transport IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
607775 6244 ENSG00000152049
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8WWG9
Protein name Potassium voltage-gated channel subfamily E member 4 (MinK-related peptide 3) (MiRP3) (Minimum potassium ion channel-related peptide 3) (Potassium channel subunit beta MiRP3)
Protein function Ancillary protein that functions as a regulatory subunit of the voltage-gated potassium (Kv) channel complex composed of pore-forming and potassium-conducting alpha subunits and of regulatory beta subunits. KCNE4 beta subunit modulates the gatin
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02060 ISK_Channel 46 137 Slow voltage-gated potassium channel Family
Tissue specificity TISSUE SPECIFICITY: Predominantly expressed in embryo and adult uterus. Low expression found in kidney, small intestine, lung and heart. {ECO:0000269|PubMed:12096056}.; TISSUE SPECIFICITY: [Isoform 1]: Detected in kidney, thymus, and uterus (at protein le
Sequence
MHFLTIYPNCSSGVVRAQSRTEQKNPLGLDDLGIQNLGQTVSLAPAVEAASMLKMEPLNS
THPGTAASSSPLESRAAGGGSGNGNEYFYILVVMSFYGIFLIGIMLGYMKSKRREKKSSL
LLLYKDEERLWGEAMKP
LPVVSGLRSVQVPLMLNMLQESVAPALSCTLCSMEGDSVSSES
SSPDVHLTIQEEGADDELEETSETPLNESSEGSSENIHQNS
Sequence length 221
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Phase 3 - rapid repolarisation
Phase 2 - plateau phase