Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
23704
Gene name Gene Name - the full gene name approved by the HGNC.
Potassium voltage-gated channel subfamily E regulatory subunit 4
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
KCNE4
Synonyms (NCBI Gene) Gene synonyms aliases
MIRP3
Chromosome Chromosome number
2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
2q36.1
Summary Summary of gene provided in NCBI Entrez Gene.
Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuro
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT681728 hsa-miR-4778-5p HITS-CLIP 23706177
MIRT681727 hsa-miR-939-3p HITS-CLIP 23706177
MIRT681726 hsa-miR-1285-3p HITS-CLIP 23706177
MIRT681725 hsa-miR-3187-5p HITS-CLIP 23706177
MIRT681724 hsa-miR-5189-5p HITS-CLIP 23706177
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005249 Function Voltage-gated potassium channel activity IEA
GO:0005251 Function Delayed rectifier potassium channel activity IBA
GO:0005267 Function Potassium channel activity IEA
GO:0005515 Function Protein binding IPI 19687231, 20533308, 32296183
GO:0006811 Process Monoatomic ion transport IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
607775 6244 ENSG00000152049
Protein
UniProt ID Q8WWG9
Protein name Potassium voltage-gated channel subfamily E member 4 (MinK-related peptide 3) (MiRP3) (Minimum potassium ion channel-related peptide 3) (Potassium channel subunit beta MiRP3)
Protein function Ancillary protein that functions as a regulatory subunit of the voltage-gated potassium (Kv) channel complex composed of pore-forming and potassium-conducting alpha subunits and of regulatory beta subunits. KCNE4 beta subunit modulates the gatin
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02060 ISK_Channel 46 137 Slow voltage-gated potassium channel Family
Tissue specificity TISSUE SPECIFICITY: Predominantly expressed in embryo and adult uterus. Low expression found in kidney, small intestine, lung and heart. {ECO:0000269|PubMed:12096056}.; TISSUE SPECIFICITY: [Isoform 1]: Detected in kidney, thymus, and uterus (at protein le
Sequence
MHFLTIYPNCSSGVVRAQSRTEQKNPLGLDDLGIQNLGQTVSLAPAVEAASMLKMEPLNS
THPGTAASSSPLESRAAGGGSGNGNEYFYILVVMSFYGIFLIGIMLGYMKSKRREKKSSL
LLLYKDEERLWGEAMKP
LPVVSGLRSVQVPLMLNMLQESVAPALSCTLCSMEGDSVSSES
SSPDVHLTIQEEGADDELEETSETPLNESSEGSSENIHQNS
Sequence length 221
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Phase 3 - rapid repolarisation
Phase 2 - plateau phase
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Metabolic Syndrome Sour taste perception in obesity with metabolic syndrome N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Atrial Fibrillation Associate 21924735, 21967835
Brugada Syndrome Associate 21967835
Heart Diseases Associate 21967835
Long QT Syndrome Associate 21967835
Neoplasms Associate 27716384
Vascular Malformations Associate 27716384