RAB38 (RAB38, member RAS oncogene family)

Gene

• Entrez ID: 23682
• Gene name: RAB38, member RAS oncogene family
• Gene symbol: RAB38
• Synonyms (NCBI Gene): NY-MEL-1, rrGTPbp
• Chromosome: 11
• Chromosome location: 11q14.2

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT022901	hsa-miR-124-3p	Microarray	18668037
MIRT032387	hsa-let-7b-5p	Proteomics	18668040
MIRT1283845	hsa-miR-633	CLIP-seq
MIRT2309423	hsa-miR-3064-3p	CLIP-seq
MIRT2309424	hsa-miR-4420	CLIP-seq
MIRT2309425	hsa-miR-4536	CLIP-seq
MIRT2309426	hsa-miR-4715-3p	CLIP-seq
MIRT2309427	hsa-miR-4768-5p	CLIP-seq
MIRT2309428	hsa-miR-9	CLIP-seq
MIRT2393336	hsa-miR-346	CLIP-seq
MIRT2393337	hsa-miR-3689d	CLIP-seq
MIRT2393338	hsa-miR-4527	CLIP-seq
MIRT2393339	hsa-miR-4802-5p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0003924	Function	GTPase activity	IBA
GO:0003924	Function	GTPase activity	IEA
GO:0003924	Function	GTPase activity	NAS	10910072
GO:0005515	Function	Protein binding	IPI	22511774, 31552791, 32814053
GO:0005525	Function	GTP binding	IEA
GO:0005525	Function	GTP binding	NAS	10910072, 22511774
GO:0005739	Component	Mitochondrion	IBA
GO:0005739	Component	Mitochondrion	IDA	25767741
GO:0005764	Component	Lysosome	IDA	25767741
GO:0005769	Component	Early endosome	IDA	22511774
GO:0005769	Component	Early endosome	IEA
GO:0005794	Component	Golgi apparatus	IEA
GO:0005802	Component	Trans-Golgi network	IBA
GO:0005802	Component	Trans-Golgi network	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IEA
GO:0006886	Process	Intracellular protein transport	IBA
GO:0007005	Process	Mitochondrion organization	IEA
GO:0007005	Process	Mitochondrion organization	IMP	25767741
GO:0007264	Process	Small GTPase-mediated signal transduction	NAS	10910072
GO:0012505	Component	Endomembrane system	IBA
GO:0015031	Process	Protein transport	IEA
GO:0015031	Process	Protein transport	NAS	10910072
GO:0016020	Component	Membrane	IDA	22511774
GO:0016020	Component	Membrane	IEA
GO:0016192	Process	Vesicle-mediated transport	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0030670	Component	Phagocytic vesicle membrane	IEA
GO:0030742	Function	GTP-dependent protein binding	IPI	22511774
GO:0031090	Component	Organelle membrane	IEA
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0031905	Component	Early endosome lumen	IDA	22511774
GO:0031982	Component	Vesicle	IEA
GO:0032438	Process	Melanosome organization	IBA
GO:0033162	Component	Melanosome membrane	IDA	23084991
GO:0033162	Component	Melanosome membrane	IEA
GO:0033162	Component	Melanosome membrane	TAS
GO:0035612	Function	AP-2 adaptor complex binding	IDA	22511774
GO:0035646	Process	Endosome to melanosome transport	IMP	22511774
GO:0035650	Function	AP-1 adaptor complex binding	IPI	22511774
GO:0035651	Function	AP-3 adaptor complex binding	IPI	22511774
GO:0036461	Function	BLOC-2 complex binding	IPI	22511774
GO:0042470	Component	Melanosome	IBA
GO:0042470	Component	Melanosome	IDA	22511774
GO:0042470	Component	Melanosome	IEA
GO:0044233	Component	Mitochondria-associated endoplasmic reticulum membrane contact site	IDA	25767741
GO:0044297	Component	Cell body	IEA
GO:0045335	Component	Phagocytic vesicle	IDA	21255211
GO:0045335	Component	Phagocytic vesicle	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0048023	Process	Positive regulation of melanin biosynthetic process	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0060155	Process	Platelet dense granule organization	IEA
GO:0072657	Process	Protein localization to membrane	IEA
GO:0072657	Process	Protein localization to membrane	IMP	22511774, 25767741
GO:0090383	Process	Phagosome acidification	IMP	21255211
GO:1903232	Process	Melanosome assembly	IDA	23084991
GO:1903232	Process	Melanosome assembly	IMP	22511774
GO:1904377	Process	Positive regulation of protein localization to cell periphery	IEA
GO:2001247	Process	Positive regulation of phosphatidylcholine biosynthetic process	IEA

Other IDs

• MIM: 606281
• HGNC: 9776
• e!Ensembl: ENSG00000123892

Protein

• UniProt ID: P57729
• Protein name: Ras-related protein Rab-38 (EC 3.6.5.2) (Melanoma antigen NY-MEL-1)
• Protein function: The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to r
• PDB: 6HDU, 6S5H
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00071	Ras	11 → 179	Ras family	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in melanocytes.
• Sequence:

  MQAPHKEHLYKLLVIGDLGVGKTSIIKRYVHQNFSSHYRATIGVDFALKVLHWDPETVVR
  LQLWDIAGQERFGNMTRVYYREAMGAFIVFDVTRPATFEAVAKWKNDLDSKLSLPNGKPV
  SVVLLANKCDQGKDVLMNNGLKMDQFCKEHGFVGWFETSAKENINIDEASRCLVKHILAN
  ECDLMESIEPDVVKPHLTSTKVASCSGCAKS

• Sequence length: 211

Pathways

Reactome:

RAB geranylgeranylation
RAB GEFs exchange GTP for GDP on RABs