Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
23671
Gene name Gene Name - the full gene name approved by the HGNC.
Transmembrane protein with EGF like and two follistatin like domains 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
TMEFF2
Synonyms (NCBI Gene) Gene synonyms aliases
CT120.2, HPP1, TENB2, TPEF, TR, TR-2
Chromosome Chromosome number
2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
2q32.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the tomoregulin family of transmembrane proteins. This protein has been shown to function as both an oncogene and a tumor suppressor depending on the cellular context and may regulate prostate cancer cell invasion. Multiple s
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT017377 hsa-miR-335-5p Microarray 18185580
MIRT022402 hsa-miR-124-3p Microarray 18668037
MIRT721792 hsa-miR-4691-3p HITS-CLIP 19536157
MIRT721791 hsa-miR-6849-3p HITS-CLIP 19536157
MIRT721790 hsa-miR-494-3p HITS-CLIP 19536157
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 26402097, 32296183, 32814053
GO:0005576 Component Extracellular region IBA
GO:0005576 Component Extracellular region IEA
GO:0006950 Process Response to stress IEA
GO:0016020 Component Membrane IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
605734 11867 ENSG00000144339
Protein
UniProt ID Q9UIK5
Protein name Tomoregulin-2 (TR-2) (Hyperplastic polyposis protein 1) (Transmembrane protein with EGF-like and two follistatin-like domains)
Protein function May be a survival factor for hippocampal and mesencephalic neurons. The shedded form up-regulates cancer cell proliferation, probably by promoting ERK1/2 phosphorylation.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07648 Kazal_2 90 135 Kazal-type serine protease inhibitor domain Domain
PF07648 Kazal_2 181 227 Kazal-type serine protease inhibitor domain Domain
Tissue specificity TISSUE SPECIFICITY: Highly expressed in adult and fetal brain, spinal cord and prostate. Expressed in all brain regions except the pituitary gland, with highest levels in amygdala and corpus callosum. Expressed in the pericryptal myofibroblasts and other
Sequence
MVLWESPRQCSSWTLCEGFCWLLLLPVMLLIVARPVKLAAFPTSLSDCQTPTGWNCSGYD
DRENDLFLCDTNTCKFDGECLRIGDTVTCVCQFKCNNDYVPVCGSNGESYQNECYLRQAA
CKQQSEILVVSEGSC
ATDAGSGSGDGVHEGSGETSQKETSTCDICQFGAECDEDAEDVWC
VCNIDCSQTNFNPLCASDGKSYDNACQIKEASCQKQEKIEVMSLGRCQDNTTTTTKSEDG
HYARTDYAENANKLEESAREHHIPCPEHYNGFCMHGKCEHSINMQEPSCRCDAGYTGQHC
EKKDYSVLYVVPGPVRFQYVLIAAVIGTIQIAVICVVVLCITRKCPRSNRIHRQKQNTGH
YSSDNTTRASTRLI
Sequence length 374
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Brain atrophy Brain atrophy N/A N/A GWAS
Colorectal Cancer Colorectal cancer N/A N/A GWAS
Ischemic Stroke Ischemic stroke N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma Associate 18831746, 22814847
Adenocarcinoma in Situ Associate 21731750
Anodontia Associate 30614793
Brain Neoplasms Inhibit 21559523
Breast Neoplasms Associate 22037257, 24080446
Carcinogenesis Associate 22814847, 30614793
Carcinoma Non Small Cell Lung Associate 22814847, 32009129
Carcinoma Renal Cell Associate 28128743
Colorectal Neoplasms Associate 16207479, 24485021, 24919179, 25774687, 26291085, 30614793, 32450419, 33504902, 34698107
Endometrial Neoplasms Associate 26522113, 31610211