Gene Gene information from NCBI Gene database.
Entrez ID 23671
Gene name Transmembrane protein with EGF like and two follistatin like domains 2
Gene symbol TMEFF2
Synonyms (NCBI Gene)
CT120.2HPP1TENB2TPEFTRTR-2
Chromosome 2
Chromosome location 2q32.3
Summary This gene encodes a member of the tomoregulin family of transmembrane proteins. This protein has been shown to function as both an oncogene and a tumor suppressor depending on the cellular context and may regulate prostate cancer cell invasion. Multiple s
miRNA miRNA information provided by mirtarbase database.
42
miRTarBase ID miRNA Experiments Reference
MIRT017377 hsa-miR-335-5p Microarray 18185580
MIRT022402 hsa-miR-124-3p Microarray 18668037
MIRT721792 hsa-miR-4691-3p HITS-CLIP 19536157
MIRT721791 hsa-miR-6849-3p HITS-CLIP 19536157
MIRT721790 hsa-miR-494-3p HITS-CLIP 19536157
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
11
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 26402097, 32296183, 32814053
GO:0005576 Component Extracellular region IBA
GO:0005576 Component Extracellular region IEA
GO:0006950 Process Response to stress IEA
GO:0016020 Component Membrane IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
605734 11867 ENSG00000144339
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9UIK5
Protein name Tomoregulin-2 (TR-2) (Hyperplastic polyposis protein 1) (Transmembrane protein with EGF-like and two follistatin-like domains)
Protein function May be a survival factor for hippocampal and mesencephalic neurons. The shedded form up-regulates cancer cell proliferation, probably by promoting ERK1/2 phosphorylation.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07648 Kazal_2 90 135 Kazal-type serine protease inhibitor domain Domain
PF07648 Kazal_2 181 227 Kazal-type serine protease inhibitor domain Domain
Tissue specificity TISSUE SPECIFICITY: Highly expressed in adult and fetal brain, spinal cord and prostate. Expressed in all brain regions except the pituitary gland, with highest levels in amygdala and corpus callosum. Expressed in the pericryptal myofibroblasts and other
Sequence
MVLWESPRQCSSWTLCEGFCWLLLLPVMLLIVARPVKLAAFPTSLSDCQTPTGWNCSGYD
DRENDLFLCDTNTCKFDGECLRIGDTVTCVCQFKCNNDYVPVCGSNGESYQNECYLRQAA
CKQQSEILVVSEGSC
ATDAGSGSGDGVHEGSGETSQKETSTCDICQFGAECDEDAEDVWC
VCNIDCSQTNFNPLCASDGKSYDNACQIKEASCQKQEKIEVMSLGRCQDNTTTTTKSEDG
HYARTDYAENANKLEESAREHHIPCPEHYNGFCMHGKCEHSINMQEPSCRCDAGYTGQHC
EKKDYSVLYVVPGPVRFQYVLIAAVIGTIQIAVICVVVLCITRKCPRSNRIHRQKQNTGH
YSSDNTTRASTRLI
Sequence length 374
Interactions View interactions