Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	23650
Gene name	Tripartite motif containing 29
Gene symbol	TRIM29
Synonyms (NCBI Gene)	ATDC
Chromosome	11
Chromosome location	11q23.3
Summary	The protein encoded by this gene belongs to the TRIM protein family. It has multiple zinc finger motifs and a leucine zipper motif. It has been proposed to form homo- or heterodimers which are involved in nucleic acid binding. Thus, it may act as a transc

133

Show/Hide all (133)

miRTarBase ID	miRNA	Experiments	Reference
MIRT002561	hsa-miR-124-3p	Microarray	15685193
MIRT018621	hsa-miR-335-5p	Microarray	18185580
MIRT002561	hsa-miR-124-3p	Microarray;Other	15685193
MIRT023394	hsa-miR-122-5p	Microarray	17612493
MIRT569614	hsa-miR-6510-5p	PAR-CLIP	20371350
MIRT569613	hsa-miR-214-3p	PAR-CLIP	20371350
MIRT569612	hsa-miR-3619-5p	PAR-CLIP	20371350
MIRT569611	hsa-miR-761	PAR-CLIP	20371350
MIRT569610	hsa-miR-6746-5p	PAR-CLIP	20371350
MIRT569609	hsa-miR-4524a-3p	PAR-CLIP	20371350
MIRT569608	hsa-miR-6132	PAR-CLIP	20371350
MIRT569607	hsa-miR-6836-5p	PAR-CLIP	20371350
MIRT569605	hsa-miR-6853-5p	PAR-CLIP	20371350
MIRT569606	hsa-miR-6731-5p	PAR-CLIP	20371350
MIRT569604	hsa-miR-8085	PAR-CLIP	20371350
MIRT569603	hsa-miR-1268a	PAR-CLIP	20371350
MIRT569602	hsa-miR-1268b	PAR-CLIP	20371350
MIRT569601	hsa-miR-1228-5p	PAR-CLIP	20371350
MIRT569600	hsa-miR-4526	PAR-CLIP	20371350
MIRT018621	hsa-miR-335-5p	Luciferase reporter assay	26872369
MIRT018621	hsa-miR-335-5p	Luciferase reporter assay	26872369
MIRT731380	hsa-miR-15b-5p	Luciferase reporter assay	26872369
MIRT731380	hsa-miR-15b-5p	Luciferase reporter assay	26872369
MIRT018621	hsa-miR-335-5p	Luciferase reporter assay	26872369
MIRT018621	hsa-miR-335-5p	Luciferase reporter assay	26872369
MIRT731749	hsa-miR-185-5p	Luciferase reporter assayqRT-PCRWestern blot	26191199
MIRT731749	hsa-miR-185-5p	Luciferase reporter assayqRT-PCRWestern blot	26191199
MIRT569614	hsa-miR-6510-5p	PAR-CLIP	20371350
MIRT569613	hsa-miR-214-3p	PAR-CLIP	20371350
MIRT569612	hsa-miR-3619-5p	PAR-CLIP	20371350
MIRT569611	hsa-miR-761	PAR-CLIP	20371350
MIRT569610	hsa-miR-6746-5p	PAR-CLIP	20371350
MIRT569609	hsa-miR-4524a-3p	PAR-CLIP	20371350
MIRT569608	hsa-miR-6132	PAR-CLIP	20371350
MIRT569607	hsa-miR-6836-5p	PAR-CLIP	20371350
MIRT569605	hsa-miR-6853-5p	PAR-CLIP	20371350
MIRT569606	hsa-miR-6731-5p	PAR-CLIP	20371350
MIRT569604	hsa-miR-8085	PAR-CLIP	20371350
MIRT569603	hsa-miR-1268a	PAR-CLIP	20371350
MIRT569602	hsa-miR-1268b	PAR-CLIP	20371350
MIRT569601	hsa-miR-1228-5p	PAR-CLIP	20371350
MIRT569600	hsa-miR-4526	PAR-CLIP	20371350
MIRT1453756	hsa-miR-1257	CLIP-seq
MIRT1453757	hsa-miR-1280	CLIP-seq
MIRT1453758	hsa-miR-1293	CLIP-seq
MIRT1453759	hsa-miR-151-3p	CLIP-seq
MIRT1453760	hsa-miR-214	CLIP-seq
MIRT1453761	hsa-miR-2467-3p	CLIP-seq
MIRT1453762	hsa-miR-2681	CLIP-seq
MIRT1453763	hsa-miR-2964a-5p	CLIP-seq
MIRT1453764	hsa-miR-3074-3p	CLIP-seq
MIRT1453765	hsa-miR-3132	CLIP-seq
MIRT1453766	hsa-miR-3137	CLIP-seq
MIRT1453767	hsa-miR-3153	CLIP-seq
MIRT1453768	hsa-miR-3165	CLIP-seq
MIRT1453769	hsa-miR-320e	CLIP-seq
MIRT1453770	hsa-miR-3607-5p	CLIP-seq
MIRT1453771	hsa-miR-3686	CLIP-seq
MIRT1453772	hsa-miR-3689d	CLIP-seq
MIRT1453773	hsa-miR-3973	CLIP-seq
MIRT1453774	hsa-miR-4280	CLIP-seq
MIRT1453775	hsa-miR-4291	CLIP-seq
MIRT1453776	hsa-miR-4433	CLIP-seq
MIRT1453777	hsa-miR-4434	CLIP-seq
MIRT1453778	hsa-miR-4459	CLIP-seq
MIRT1453779	hsa-miR-4463	CLIP-seq
MIRT1453780	hsa-miR-4475	CLIP-seq
MIRT1453781	hsa-miR-4483	CLIP-seq
MIRT1453782	hsa-miR-4499	CLIP-seq
MIRT1453783	hsa-miR-4516	CLIP-seq
MIRT1453784	hsa-miR-4640-5p	CLIP-seq
MIRT1453785	hsa-miR-4646-5p	CLIP-seq
MIRT1453786	hsa-miR-4687-3p	CLIP-seq
MIRT1453787	hsa-miR-4694-3p	CLIP-seq
MIRT1453788	hsa-miR-4722-3p	CLIP-seq
MIRT1453789	hsa-miR-4722-5p	CLIP-seq
MIRT1453790	hsa-miR-4726-5p	CLIP-seq
MIRT1453791	hsa-miR-4747-5p	CLIP-seq
MIRT1453792	hsa-miR-4768-3p	CLIP-seq
MIRT1453793	hsa-miR-4778-5p	CLIP-seq
MIRT1453794	hsa-miR-4786-3p	CLIP-seq
MIRT1453795	hsa-miR-4793-5p	CLIP-seq
MIRT1453796	hsa-miR-4796-3p	CLIP-seq
MIRT1453797	hsa-miR-520g	CLIP-seq
MIRT1453798	hsa-miR-520h	CLIP-seq
MIRT1453799	hsa-miR-522	CLIP-seq
MIRT1453800	hsa-miR-541	CLIP-seq
MIRT1453801	hsa-miR-654-5p	CLIP-seq
MIRT1453802	hsa-miR-661	CLIP-seq
MIRT1453803	hsa-miR-888	CLIP-seq
MIRT1453804	hsa-miR-922	CLIP-seq
MIRT1453756	hsa-miR-1257	CLIP-seq
MIRT2136079	hsa-miR-1287	CLIP-seq
MIRT2136080	hsa-miR-1470	CLIP-seq
MIRT1453760	hsa-miR-214	CLIP-seq
MIRT2136081	hsa-miR-2276	CLIP-seq
MIRT1453767	hsa-miR-3153	CLIP-seq
MIRT1453769	hsa-miR-320e	CLIP-seq
MIRT2136082	hsa-miR-34a	CLIP-seq
MIRT2136083	hsa-miR-34c-5p	CLIP-seq
MIRT1453770	hsa-miR-3607-5p	CLIP-seq
MIRT1453772	hsa-miR-3689d	CLIP-seq
MIRT2136084	hsa-miR-4287	CLIP-seq
MIRT2136085	hsa-miR-4302	CLIP-seq
MIRT2136086	hsa-miR-4447	CLIP-seq
MIRT1453778	hsa-miR-4459	CLIP-seq
MIRT2136087	hsa-miR-4469	CLIP-seq
MIRT2136088	hsa-miR-4472	CLIP-seq
MIRT2136089	hsa-miR-4488	CLIP-seq
MIRT2136090	hsa-miR-449a	CLIP-seq
MIRT2136091	hsa-miR-449b	CLIP-seq
MIRT1453784	hsa-miR-4640-5p	CLIP-seq
MIRT2136092	hsa-miR-4667-3p	CLIP-seq
MIRT2136093	hsa-miR-4685-3p	CLIP-seq
MIRT2136094	hsa-miR-4697-5p	CLIP-seq
MIRT1453789	hsa-miR-4722-5p	CLIP-seq
MIRT1453790	hsa-miR-4726-5p	CLIP-seq
MIRT2136095	hsa-miR-4764-5p	CLIP-seq
MIRT2136096	hsa-miR-486-3p	CLIP-seq
MIRT1453800	hsa-miR-541	CLIP-seq
MIRT1453801	hsa-miR-654-5p	CLIP-seq
MIRT1453760	hsa-miR-214	CLIP-seq
MIRT1453778	hsa-miR-4459	CLIP-seq
MIRT2396346	hsa-miR-15a	CLIP-seq
MIRT2396347	hsa-miR-15b	CLIP-seq
MIRT2396348	hsa-miR-16	CLIP-seq
MIRT2396349	hsa-miR-195	CLIP-seq
MIRT1453760	hsa-miR-214	CLIP-seq
MIRT2396350	hsa-miR-2278	CLIP-seq
MIRT2396351	hsa-miR-335	CLIP-seq
MIRT2396352	hsa-miR-424	CLIP-seq
MIRT1453778	hsa-miR-4459	CLIP-seq
MIRT2396353	hsa-miR-497	CLIP-seq

Show/Hide all (14)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0002039	Function	P53 binding	IEA
GO:0002376	Process	Immune system process	IEA
GO:0005515	Function	Protein binding	IPI	16189514, 19249679, 21516116, 25416956, 31515488, 32296183, 36217030, 37671092
GO:0005737	Component	Cytoplasm	IEA
GO:0005764	Component	Lysosome	IEA
GO:0005912	Component	Adherens junction	HDA	25468996
GO:0008270	Function	Zinc ion binding	IEA
GO:0042802	Function	Identical protein binding	IPI	16189514, 20211142, 32296183
GO:0045087	Process	Innate immune response	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0098609	Process	Cell-cell adhesion	IEA
GO:0098641	Function	Cadherin binding involved in cell-cell adhesion	HDA	25468996
GO:1900181	Process	Negative regulation of protein localization to nucleus	IEA

MIM	HGNC	e!Ensembl
610658	17274	ENSG00000137699

Q14134

Protein name

Tripartite motif-containing protein 29 (Ataxia telangiectasia group D-associated protein)

Protein function

Plays a crucial role in the regulation of macrophage activation in response to viral or bacterial infections within the respiratory tract. Mechanistically, TRIM29 interacts with IKBKG/NEMO in the lysosome where it induces its 'Lys-48' ubiquitina

PDB

2CSV

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00643	zf-B_box	220 → 260	B-box zinc finger	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in placenta, prostate and thymus. {ECO:0000269|PubMed:11331580}.

Sequence

MEAADASRSNGSSPEARDARSPSGPSGSLENGTKADGKDAKTTNGHGGEAAEGKSLGSAL
KPGEGRSALFAGNEWRRPIIQFVESGDDKNSNYFSMDSMEGKRSPYAGLQLGAAKKPPVT
FAEKGELRKSIFSESRKPTVSIMEPGETRRNSYPRADTGLFSRSKSGSEEVLCDSCIGNK
QKAVKSCLVCQASFCELHLKPHLEGAAFRDHQLLEPIRDFEARKCPVHGKTMELFCQTDQ
TCICYLCMFQEHKNHSTVTVEEAKAEKETELSLQKEQLQLKIIEIEDEAEKWQKEKDRIK
SFTTNEKAILEQNFRDLVRDLEKQKEEVRAALEQREQDAVDQVKVIMDALDERAKVLHED
KQTREQLHSISDSVLFLQEFGALMSNYSLPPPLPTYHVLLEGEGLGQSLGNFKDDLLNVC
MRHVEKMCKADLSRNFIERNHMENGGDHRYVNNYTNSFGGEWSAPDTMKRYSMYLTPKGG
VRTSYQPSSPGRFTKETTQKNFNNLYGTKGNYTSRVWEYSSSIQNSDNDLPVVQGSSSFS
LKGYPSLMRSQSPKAQPQTWKSGKQTMLSHYRPFYVNKGNGIGSNEAP

Sequence length

588

Interactions

View interactions

	Reactome
			Interferon gamma signaling

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Clear cell carcinoma of kidney	Uncertain significance	rs76879753	RCV005929275
Hepatocellular carcinoma	Uncertain significance	rs76879753	RCV005929274
Ovarian serous cystadenocarcinoma	Uncertain significance	rs76879753	RCV005929276

Show/Hide Text Mining Associations (42)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Adenocarcinoma	Associate	22721621
Ataxia Telangiectasia	Associate	1609804
Breast Neoplasms	Inhibit	22138580, 24950909, 27535224
Breast Neoplasms	Associate	24651077, 28216417
Carcinogenesis	Associate	27081037, 33446568
Carcinoma Hepatocellular	Inhibit	30566565
Carcinoma Non Small Cell Lung	Associate	22721621, 32901838
Carcinoma Non Small Cell Lung	Stimulate	26599082
Carcinoma Pancreatic Ductal	Associate	24864129
Carcinoma Squamous Cell	Associate	22721621, 32640423
Colorectal Neoplasms	Stimulate	33495406, 37837384
Colorectal Neoplasms	Associate	33824865
Hematologic Neoplasms	Associate	22138580
Hepatitis B	Inhibit	24651077
Hereditary Breast and Ovarian Cancer Syndrome	Associate	24651077
Hypoxia	Stimulate	27535224
Hypoxia Brain	Stimulate	27535224
Leukemia Biphenotypic Acute	Associate	39384181
Lymphatic Metastasis	Associate	22721621, 24864129, 27145374, 29693120
Lymphatic Metastasis	Stimulate	27081037, 33495406
Machado Joseph Disease	Associate	32205469
Melanoma	Associate	33118318
Nasopharyngeal Carcinoma	Associate	27145374, 29693120, 37248790
Neoplasm Invasiveness	Associate	23201130
Neoplasm Metastasis	Associate	25295583, 29693120, 30643195, 33118318
Neoplasm Metastasis	Stimulate	27145374, 33446568
Neoplasms	Inhibit	12057920, 22138580, 22721621, 24651077, 26191199, 27535224
Neoplasms	Associate	24864129, 24950909, 26381412, 27081037, 29693120, 30566565, 30643195, 32994394, 33011193, 33118318, 33495406
Neoplasms	Stimulate	33446568, 37837384
Neoplasms Basal Cell	Associate	26987391
Ovarian Neoplasms	Associate	33011193
Pancreatic Neoplasms	Associate	24864129
Pancreatic Neoplasms	Stimulate	33011193, 33446568
Personality Disorders	Associate	30643195
Prostatic Neoplasms	Associate	12057920, 24485335
Prostatitis	Associate	24485335
Stomach Neoplasms	Associate	26191199, 36876422
Thyroid Cancer Papillary	Associate	32994394, 33318312
Urethral Neoplasms	Associate	23201130
Urinary Bladder Neoplasms	Associate	23201130, 26987391, 30643195
Uterine Cervical Neoplasms	Associate	26071105
Uterine Cervical Neoplasms	Stimulate	27081037

TRIM29 (tripartite motif containing 29)