Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	23648
Gene name	Single stranded DNA binding protein 3
Gene symbol	SSBP3
Synonyms (NCBI Gene)	CSDPSSDPSSDP1
Chromosome	1
Chromosome location	1p32.3

Show/Hide all (79)

miRTarBase ID	miRNA	Experiments	Reference
MIRT622040	hsa-miR-29b-1-5p	HITS-CLIP	23824327
MIRT622040	hsa-miR-29b-1-5p	HITS-CLIP	23824327
MIRT622040	hsa-miR-29b-1-5p	HITS-CLIP	23824327
MIRT622040	hsa-miR-29b-1-5p	HITS-CLIP	23824327
MIRT622040	hsa-miR-29b-1-5p	HITS-CLIP	23824327
MIRT622040	hsa-miR-29b-1-5p	HITS-CLIP	23824327
MIRT1391648	hsa-miR-1290	CLIP-seq
MIRT1391649	hsa-miR-2110	CLIP-seq
MIRT1391650	hsa-miR-3121-5p	CLIP-seq
MIRT1391651	hsa-miR-3150a-3p	CLIP-seq
MIRT1391652	hsa-miR-3153	CLIP-seq
MIRT1391653	hsa-miR-3936	CLIP-seq
MIRT1391654	hsa-miR-4260	CLIP-seq
MIRT1391655	hsa-miR-4271	CLIP-seq
MIRT1391656	hsa-miR-4651	CLIP-seq
MIRT1391657	hsa-miR-4654	CLIP-seq
MIRT1391658	hsa-miR-4725-3p	CLIP-seq
MIRT1391659	hsa-miR-4769-5p	CLIP-seq
MIRT1391660	hsa-miR-608	CLIP-seq
MIRT2117282	hsa-miR-1324	CLIP-seq
MIRT2117283	hsa-miR-153	CLIP-seq
MIRT2117284	hsa-miR-214	CLIP-seq
MIRT2117285	hsa-miR-3128	CLIP-seq
MIRT2117286	hsa-miR-3158-3p	CLIP-seq
MIRT2117287	hsa-miR-3619-5p	CLIP-seq
MIRT2117288	hsa-miR-448	CLIP-seq
MIRT2117289	hsa-miR-4642	CLIP-seq
MIRT2117290	hsa-miR-4720-5p	CLIP-seq
MIRT2117291	hsa-miR-4799-3p	CLIP-seq
MIRT2117292	hsa-miR-761	CLIP-seq
MIRT1391648	hsa-miR-1290	CLIP-seq
MIRT2117282	hsa-miR-1324	CLIP-seq
MIRT2117283	hsa-miR-153	CLIP-seq
MIRT2339545	hsa-miR-203	CLIP-seq
MIRT2117285	hsa-miR-3128	CLIP-seq
MIRT2117286	hsa-miR-3158-3p	CLIP-seq
MIRT2339546	hsa-miR-3202	CLIP-seq
MIRT2339547	hsa-miR-3663-5p	CLIP-seq
MIRT1391653	hsa-miR-3936	CLIP-seq
MIRT2339548	hsa-miR-4258	CLIP-seq
MIRT2339549	hsa-miR-4420	CLIP-seq
MIRT2117288	hsa-miR-448	CLIP-seq
MIRT2117289	hsa-miR-4642	CLIP-seq
MIRT1391656	hsa-miR-4651	CLIP-seq
MIRT1391657	hsa-miR-4654	CLIP-seq
MIRT2117290	hsa-miR-4720-5p	CLIP-seq
MIRT2339550	hsa-miR-4763-5p	CLIP-seq
MIRT1391659	hsa-miR-4769-5p	CLIP-seq
MIRT2117291	hsa-miR-4799-3p	CLIP-seq
MIRT1391660	hsa-miR-608	CLIP-seq
MIRT2339551	hsa-miR-635	CLIP-seq
MIRT2117283	hsa-miR-153	CLIP-seq
MIRT2117288	hsa-miR-448	CLIP-seq
MIRT2117284	hsa-miR-214	CLIP-seq
MIRT2117286	hsa-miR-3158-3p	CLIP-seq
MIRT2117287	hsa-miR-3619-5p	CLIP-seq
MIRT2117292	hsa-miR-761	CLIP-seq
MIRT2117283	hsa-miR-153	CLIP-seq
MIRT2117284	hsa-miR-214	CLIP-seq
MIRT2117285	hsa-miR-3128	CLIP-seq
MIRT2117286	hsa-miR-3158-3p	CLIP-seq
MIRT2117287	hsa-miR-3619-5p	CLIP-seq
MIRT2633462	hsa-miR-3917	CLIP-seq
MIRT2339548	hsa-miR-4258	CLIP-seq
MIRT2117288	hsa-miR-448	CLIP-seq
MIRT2117289	hsa-miR-4642	CLIP-seq
MIRT2117290	hsa-miR-4720-5p	CLIP-seq
MIRT2339550	hsa-miR-4763-5p	CLIP-seq
MIRT2117291	hsa-miR-4799-3p	CLIP-seq
MIRT2117292	hsa-miR-761	CLIP-seq
MIRT2117283	hsa-miR-153	CLIP-seq
MIRT2117285	hsa-miR-3128	CLIP-seq
MIRT2633462	hsa-miR-3917	CLIP-seq
MIRT2339548	hsa-miR-4258	CLIP-seq
MIRT2117288	hsa-miR-448	CLIP-seq
MIRT2117289	hsa-miR-4642	CLIP-seq
MIRT2117290	hsa-miR-4720-5p	CLIP-seq
MIRT2339550	hsa-miR-4763-5p	CLIP-seq
MIRT2117291	hsa-miR-4799-3p	CLIP-seq

Show/Hide all (20)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002244	Process	Hematopoietic progenitor cell differentiation	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003697	Function	Single-stranded DNA binding	IEA
GO:0003713	Function	Transcription coactivator activity	IEA
GO:0005515	Function	Protein binding	IPI	18330356, 20211142, 25416956, 30833792, 32296183, 33961781
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005667	Component	Transcription regulator complex	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0021501	Process	Prechordal plate formation	IEA
GO:0021547	Process	Midbrain-hindbrain boundary initiation	IEA
GO:0032991	Component	Protein-containing complex	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IBA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0048382	Process	Mesendoderm development	IEA
GO:0060322	Process	Head development	IEA
GO:0060323	Process	Head morphogenesis	IEA
GO:0065003	Process	Protein-containing complex assembly	IEA
GO:2000744	Process	Positive regulation of anterior head development	IEA

MIM	HGNC	e!Ensembl
607390	15674	ENSG00000157216

Q9BWW4

Protein name

Single-stranded DNA-binding protein 3 (Sequence-specific single-stranded-DNA-binding protein)

Protein function

May be involved in transcription regulation of the alpha 2(I) collagen gene where it binds to the single-stranded polypyrimidine sequences in the promoter region.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF04503	SSDP	81 → 365		Family

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in all hematopoietic tissues, including spleen, lymph node, peripheral blood, bone marrow, thymus, and fetal liver, with highest expression in thymus and fetal liver. Expression is also high in heart, brain, kidney, an

Sequence

MFAKGKGSAVPSDGQAREKLALYVYEYLLHVGAQKSAQTFLSEIRWEKNITLGEPPGFLH
SWWCVFWDLYCAAPERRDTCEHSSEAKAFHDYSAAAAPSPVLGNIPPNDGMPGGPIPPGF
FQGPPGSQPSPHAQPPPHNPSSMMGPHSQPFMSPRYAGGPRPPIRMGNQPPGGVPGTQPL
LPNSMDPTRQQGHPNMGGSMQRMNPPRGMGPMGPGPQNYGSGMRPPPNSLGPAMPGINMG
PGAGRPWPNPNSANSIPYSSSSPGTYVGPPGGGGPPGTPIMPSPADSTNSSDNIYTMINP
VPPGGSRSNFPMGPGSDGPMGGMGGMEPHHMNGSLGSGDIDGLPKNSPNNISGISNPPGT
PRDDGELGGNFLHSFQNDNYSPSMTMSV

Sequence length

388

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (15)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEVELOPMENTAL DISABILITIES	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Developmental disorder	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FUCHS ENDOTHELIAL CORNEAL DYSTROPHY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOBLASTOMA MULTIFORME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPEROPIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neurodevelopmental disorder	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURODEVELOPMENTAL DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (3)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Jervell Lange Nielsen Syndrome	Associate	31570892	★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Associate	36273157	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	36273157	★★★★★ ★☆☆☆☆ Found in Text Mining only

SSBP3 (single stranded DNA binding protein 3)