Gene Gene information from NCBI Gene database.
Entrez ID 23646
Gene name Phospholipase D family member 3
Gene symbol PLD3
Synonyms (NCBI Gene)
AD19HU-K4HUK4SCA46
Chromosome 19
Chromosome location 19q13.2
Summary This gene encodes a member of the phospholipase D (PLD) family of enzymes that catalyze the hydrolysis of membrane phospholipids. The encoded protein is a single-pass type II membrane protein and contains two PLD phosphodiesterase domains. This protein in
miRNA miRNA information provided by mirtarbase database.
163
miRTarBase ID miRNA Experiments Reference
MIRT017099 hsa-miR-335-5p Microarray 18185580
MIRT051205 hsa-miR-16-5p CLASH 23622248
MIRT044846 hsa-miR-320a CLASH 23622248
MIRT044846 hsa-miR-320a CLASH 23622248
MIRT042303 hsa-miR-484 CLASH 23622248
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
34
GO ID Ontology Definition Evidence Reference
GO:0000139 Component Golgi membrane IDA 29368044
GO:0000139 Component Golgi membrane IEA
GO:0002376 Process Immune system process IEA
GO:0003824 Function Catalytic activity IEA
GO:0004518 Function Nuclease activity IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
615698 17158 ENSG00000105223
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8IV08
Protein name 5'-3' exonuclease PLD3 (EC 3.1.16.1) ((S,S)-bis(monoacylglycero)phosphate synthase PLD3) (EC 3.1.4.-) (HindIII K4L homolog) (Hu-K4) (Phospholipase D3)
Protein function 5'->3' exonuclease that hydrolyzes the phosphodiester bond of single-stranded DNA (ssDNA) and RNA molecules to form nucleoside 3'-monophosphates and 5'-end 5'-hydroxy deoxyribonucleotide/ribonucleotide fragments (PubMed:30111894, PubMed:30312375
PDB 8Q1K , 8Q1X , 8S86 , 8V5T
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13918 PLDc_3 226 403 PLD-like domain Domain
Tissue specificity TISSUE SPECIFICITY: Widely expressed. In the brain, high levels of expression are detected in the frontal, temporal and occipital cortices and hippocampus. Expressed at low level in corpus callosum. Expressed in plasmacytoid dendritic cells and monocytes
Sequence
MKPKLMYQELKVPAEEPANELPMNEIEAWKAAEKKARWVLLVLILAVVGFGALMTQLFLW
EYGDLHLFGPNQRPAPCYDPCEAVLVESIPEGLDFPNASTGNPSTSQAWLGLLAGAHSSL
DIASFYWTLTNNDTHTQEPSAQQGEEVLRQLQTLAPKGVNVRIAVSKPSGPQPQADLQAL
LQSGAQVRMVDMQKLTHGVLHTKFWVVDQTHFYLGSANMDWRSLTQVKELGVVMYNCSCL
ARDLTKIFEAYWFLGQAGSSIPSTWPRFYDTRYNQETPMEICLNGTPALAYLASAPPPLC
PSGRTPDLKALLNVVDNARSFIYVAVMNYLPTLEFSHPHRFWPAIDDGLRRATYERGVKV
RLLISCWGHSEPSMRAFLLSLAALRDNHTHSDIQVKLFVVPAD
EAQARIPYARVNHNKYM
VTERATYIGTSNWSGNYFTETAGTSLLVTQNGRGGLRSQLEAIFLRDWDSPYSHDLDTSA
DSVGNACRLL
Sequence length 490
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Glycerophospholipid metabolism
Ether lipid metabolism
Metabolic pathways
  Role of phospholipids in phagocytosis
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
30
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Spinocerebellar ataxia 46 Pathogenic rs1317590341 RCV000990215
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Alzheimer disease 19 Benign; Likely benign rs145999145 RCV000106322
Cervical cancer Likely benign rs200368701 RCV005935061
Familial cancer of breast Benign rs3745198, rs3745199 RCV005926982
RCV005928578
Gastric cancer Uncertain significance rs752779193 RCV005932419
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Alzheimer Disease Associate 24336208, 26402410, 26411346, 28199971, 29386126, 29395285, 29750252, 30208929, 32941707, 33288674, 36516243, 37925455
Alzheimer Disease Inhibit 30208929
Breast Neoplasms Inhibit 37978168
Carcinoma Pancreatic Ductal Associate 35255936
Cognition Disorders Associate 28199971
COVID 19 Associate 33971585
Dementia Associate 29750252, 31836585
Infections Associate 10074127
Lupus Erythematosus Systemic Associate 33288674
Neoplasms Associate 37978168