Gene Gene information from NCBI Gene database.
Entrez ID 23639
Gene name Dynein axonemal assembly factor 11
Gene symbol DNAAF11
Synonyms (NCBI Gene)
CILD19LRRC6LRTPTSLRPtilB
Chromosome 8
Chromosome location 8q24.22
Summary The protein encoded by this gene contains several leucine-rich repeat domains and appears to be involved in the motility of cilia. Defects in this gene are a cause of primary ciliary dyskinesia-19 (CILD19). Alternative splicing of this gene results in mul
SNPs SNP information provided by dbSNP.
12
SNP ID Visualize variation Clinical significance Consequence
rs139131485 G>A Likely-benign, conflicting-interpretations-of-pathogenicity Non coding transcript variant, missense variant, coding sequence variant
rs141945265 G>A,C Likely-benign, pathogenic Stop gained, coding sequence variant, missense variant, intron variant, non coding transcript variant
rs200321595 C>G Pathogenic Non coding transcript variant, missense variant, intron variant, coding sequence variant
rs397514596 C>G Pathogenic Coding sequence variant, intron variant, non coding transcript variant, missense variant, 5 prime UTR variant
rs397515424 TT>- Pathogenic Coding sequence variant, frameshift variant, intron variant, non coding transcript variant
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
47
GO ID Ontology Definition Evidence Reference
GO:0003341 Process Cilium movement IEA
GO:0003341 Process Cilium movement IMP 23122589
GO:0003351 Process Epithelial cilium movement involved in extracellular fluid movement IEA
GO:0003351 Process Epithelial cilium movement involved in extracellular fluid movement ISS
GO:0005515 Function Protein binding IPI 23891469, 23891471, 25036637, 29601588, 32296183, 33961781
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
614930 16725 ENSG00000129295
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q86X45
Protein name Dynein axonemal assembly factor 11 (DNAAF11) (Leucine-rich repeat-containing protein 6) (Leucine-rich testis-specific protein) (Protein tilB homolog) (Testis-specific leucine-rich repeat protein)
Protein function Involved in dynein arm assembly, is important for expression and transporting outer dynein arm (ODA) proteins from the cytoplasm to the cilia (PubMed:23122589, PubMed:23527195, PubMed:33403504). Acts as a crucial component in the formation and m
Family and domains
Tissue specificity TISSUE SPECIFICITY: Expressed predominantly in testis and in nasal epithelial cells. {ECO:0000269|PubMed:23122589, ECO:0000269|PubMed:23527195, ECO:0000269|PubMed:33403504}.
Sequence
MGWITEDLIRRNAEHNDCVIFSLEELSLHQQEIERLEHIDKWCRDLKILYLQNNLIGKIE
NVSKLKKLEYLNLALNNIEKIENLEGCEELAKLDLTVNFIGELSSIKNLQHNIHLKELFL
MGNPCASFDHYREFVVATLPQLKWLDGKEIEPSERIKALQDYSVIEPQIREQEKDHCLKR
AKLKEEAQRKHQEEDKNEDKRSNAGFDGRWYTDINATLSSLESKDHLQAPDTEEHNTKKL
DNSEDDLEFWNKPCLFTPESRLETLRHMEKQRKKQEKLSEKKKKVKPPRTLITEDGKALN
VNEPKIDFSLKDNEKQIILDLAVYRYMDTSLIDVDVQPTYVRVMIKGKPFQLVLPAEVKP
DSSSAKRSQTTGHLVICMPKVGEVITGGQRAFKSMKTTSDRSREQTNTRSKHMEKLEVDP
SKHSFPDVTNIVQEKKHTPRRRPEPKIIPSEEDPTFEDNPEVPPLI
Sequence length 466
Interactions View interactions
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
309
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
DNAAF11-related disorder Pathogenic; Likely pathogenic rs760123202, rs1821460043 RCV004748646
RCV003397602
Heterotaxy Likely pathogenic; Pathogenic rs200321595 RCV001731475
Kartagener syndrome Pathogenic rs760123202 RCV000190917
Primary ciliary dyskinesia Pathogenic; Likely pathogenic rs771548650, rs150975285, rs777779770, rs760123202, rs200321595, rs769220870, rs1586586381, rs979934112, rs1821475039 RCV002463318
RCV002461458
RCV002461521
RCV002460965
RCV002460894
RCV002461968
RCV002462172
RCV005912424
RCV001255258
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Infertility disorder Uncertain significance rs200906172 RCV001327950
Multiple sclerosis, susceptibility to Conflicting classifications of pathogenicity rs139131485 RCV001823000
Respiratory ciliopathies including non-CF bronchiectasis Conflicting classifications of pathogenicity rs139008774 RCV005646778
Thyroid cancer, nonmedullary, 1 Uncertain significance rs376633613 RCV005899316