Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
23639
Gene name Gene Name - the full gene name approved by the HGNC.
Dynein axonemal assembly factor 11
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
DNAAF11
Synonyms (NCBI Gene) Gene synonyms aliases
CILD19, LRRC6, LRTP, TSLRP, tilB
Chromosome Chromosome number
8
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
8q24.22
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene contains several leucine-rich repeat domains and appears to be involved in the motility of cilia. Defects in this gene are a cause of primary ciliary dyskinesia-19 (CILD19). Alternative splicing of this gene results in mul
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs139131485 G>A Likely-benign, conflicting-interpretations-of-pathogenicity Non coding transcript variant, missense variant, coding sequence variant
rs141945265 G>A,C Likely-benign, pathogenic Stop gained, coding sequence variant, missense variant, intron variant, non coding transcript variant
rs200321595 C>G Pathogenic Non coding transcript variant, missense variant, intron variant, coding sequence variant
rs397514596 C>G Pathogenic Coding sequence variant, intron variant, non coding transcript variant, missense variant, 5 prime UTR variant
rs397515424 TT>- Pathogenic Coding sequence variant, frameshift variant, intron variant, non coding transcript variant
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0003341 Process Cilium movement IEA
GO:0003341 Process Cilium movement IMP 23122589
GO:0003351 Process Epithelial cilium movement involved in extracellular fluid movement IEA
GO:0003351 Process Epithelial cilium movement involved in extracellular fluid movement ISS
GO:0005515 Function Protein binding IPI 23891469, 23891471, 25036637, 29601588, 32296183, 33961781
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
614930 16725 ENSG00000129295
Protein
UniProt ID Q86X45
Protein name Dynein axonemal assembly factor 11 (DNAAF11) (Leucine-rich repeat-containing protein 6) (Leucine-rich testis-specific protein) (Protein tilB homolog) (Testis-specific leucine-rich repeat protein)
Protein function Involved in dynein arm assembly, is important for expression and transporting outer dynein arm (ODA) proteins from the cytoplasm to the cilia (PubMed:23122589, PubMed:23527195, PubMed:33403504). Acts as a crucial component in the formation and m
Family and domains
Tissue specificity TISSUE SPECIFICITY: Expressed predominantly in testis and in nasal epithelial cells. {ECO:0000269|PubMed:23122589, ECO:0000269|PubMed:23527195, ECO:0000269|PubMed:33403504}.
Sequence
MGWITEDLIRRNAEHNDCVIFSLEELSLHQQEIERLEHIDKWCRDLKILYLQNNLIGKIE
NVSKLKKLEYLNLALNNIEKIENLEGCEELAKLDLTVNFIGELSSIKNLQHNIHLKELFL
MGNPCASFDHYREFVVATLPQLKWLDGKEIEPSERIKALQDYSVIEPQIREQEKDHCLKR
AKLKEEAQRKHQEEDKNEDKRSNAGFDGRWYTDINATLSSLESKDHLQAPDTEEHNTKKL
DNSEDDLEFWNKPCLFTPESRLETLRHMEKQRKKQEKLSEKKKKVKPPRTLITEDGKALN
VNEPKIDFSLKDNEKQIILDLAVYRYMDTSLIDVDVQPTYVRVMIKGKPFQLVLPAEVKP
DSSSAKRSQTTGHLVICMPKVGEVITGGQRAFKSMKTTSDRSREQTNTRSKHMEKLEVDP
SKHSFPDVTNIVQEKKHTPRRRPEPKIIPSEEDPTFEDNPEVPPLI
Sequence length 466
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Ciliary dyskinesia primary ciliary dyskinesia, Primary ciliary dyskinesia 19 rs769220870, rs397515425, rs763900107, rs200321595, rs1586586381, rs767624733, rs397515461, rs979934112, rs760123202, rs1815572053, rs750603177, rs397515424, rs141945265 N/A
Heterotaxia Heterotaxy rs200321595 N/A
Kartagener Syndrome kartagener syndrome rs760123202 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Multiple Sclerosis Multiple sclerosis, susceptibility to N/A N/A ClinVar
Sarcoidosis Sarcoidosis N/A N/A GWAS