Gene Gene information from NCBI Gene database.
Entrez ID 23612
Gene name Pleckstrin homology like domain family A member 3
Gene symbol PHLDA3
Synonyms (NCBI Gene)
TIH1
Chromosome 1
Chromosome location 1q32.1
miRNA miRNA information provided by mirtarbase database.
858
miRTarBase ID miRNA Experiments Reference
MIRT039099 hsa-miR-769-3p CLASH 23622248
MIRT717597 hsa-miR-1224-3p HITS-CLIP 19536157
MIRT717596 hsa-miR-4641 HITS-CLIP 19536157
MIRT717595 hsa-miR-6875-3p HITS-CLIP 19536157
MIRT717594 hsa-miR-4659a-3p HITS-CLIP 19536157
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
20
GO ID Ontology Definition Evidence Reference
GO:0005546 Function Phosphatidylinositol-4,5-bisphosphate binding IDA 19203586
GO:0005547 Function Phosphatidylinositol-3,4,5-trisphosphate binding IDA 19203586
GO:0005737 Component Cytoplasm IEA
GO:0005886 Component Plasma membrane IBA
GO:0005886 Component Plasma membrane IDA 19203586
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
607054 8934 ENSG00000174307
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9Y5J5
Protein name Pleckstrin homology-like domain family A member 3 (TDAG51/Ipl homolog 1)
Protein function p53/TP53-regulated repressor of Akt/AKT1 signaling. Represses AKT1 by preventing AKT1-binding to membrane lipids, thereby inhibiting AKT1 translocation to the cellular membrane and activation. Contributes to p53/TP53-dependent apoptosis by repre
Family and domains
Tissue specificity TISSUE SPECIFICITY: Widely expressed with lowest expression in liver and spleen. {ECO:0000269|PubMed:10594239}.
Sequence
MTAAATATVLKEGVLEKRSGGLLQLWKRKRCVLTERGLQLFEAKGTGGRPKELSFARIKA
VECVESTGRHIYFTLVTEGGGEIDFRCPLEDPGWNAQITLGLVKFKNQQAIQTVRARQSL
GTGTLVS
Sequence length 127
Interactions View interactions