Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
23612
Gene name Gene Name - the full gene name approved by the HGNC.
Pleckstrin homology like domain family A member 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
PHLDA3
Synonyms (NCBI Gene) Gene synonyms aliases
TIH1
Chromosome Chromosome number
1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
1q32.1
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT039099 hsa-miR-769-3p CLASH 23622248
MIRT717597 hsa-miR-1224-3p HITS-CLIP 19536157
MIRT717596 hsa-miR-4641 HITS-CLIP 19536157
MIRT717595 hsa-miR-6875-3p HITS-CLIP 19536157
MIRT717594 hsa-miR-4659a-3p HITS-CLIP 19536157
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005546 Function Phosphatidylinositol-4,5-bisphosphate binding IDA 19203586
GO:0005547 Function Phosphatidylinositol-3,4,5-trisphosphate binding IDA 19203586
GO:0005737 Component Cytoplasm IEA
GO:0005886 Component Plasma membrane IBA
GO:0005886 Component Plasma membrane IDA 19203586
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
607054 8934 ENSG00000174307
Protein
UniProt ID Q9Y5J5
Protein name Pleckstrin homology-like domain family A member 3 (TDAG51/Ipl homolog 1)
Protein function p53/TP53-regulated repressor of Akt/AKT1 signaling. Represses AKT1 by preventing AKT1-binding to membrane lipids, thereby inhibiting AKT1 translocation to the cellular membrane and activation. Contributes to p53/TP53-dependent apoptosis by repre
Family and domains
Tissue specificity TISSUE SPECIFICITY: Widely expressed with lowest expression in liver and spleen. {ECO:0000269|PubMed:10594239}.
Sequence
MTAAATATVLKEGVLEKRSGGLLQLWKRKRCVLTERGLQLFEAKGTGGRPKELSFARIKA
VECVESTGRHIYFTLVTEGGGEIDFRCPLEDPGWNAQITLGLVKFKNQQAIQTVRARQSL
GTGTLVS
Sequence length 127
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Breast Cancer Breast cancer N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 34006890
Hypoxia Associate 25961455
Lung Neoplasms Stimulate 34006890
Lymphatic Metastasis Associate 30787304
Neoplasms Inhibit 28483946
Neoplasms Associate 30787304, 34006890, 35112982
Neuroendocrine Tumors Associate 26894863, 30787304
Osteosarcoma Associate 35112982
Pancreatitis Associate 30787304