Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
23603
Gene name Gene Name - the full gene name approved by the HGNC.
Coronin 1C
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CORO1C
Synonyms (NCBI Gene) Gene synonyms aliases
HCRNN4
Chromosome Chromosome number
12
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
12q24.11
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein com
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT001375 hsa-miR-1-3p pSILAC 18668040
MIRT019935 hsa-miR-375 Microarray 20215506
MIRT021303 hsa-miR-125a-5p Sequencing 20371350
MIRT001375 hsa-miR-1-3p Proteomics;Other 18668040
MIRT028565 hsa-miR-30a-5p Proteomics 18668040
Transcription factors
Transcription factor Regulation Reference
NR1I2 Activation 21072196
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001755 Process Neural crest cell migration IBA
GO:0001755 Process Neural crest cell migration IMP 25074804
GO:0001932 Process Regulation of protein phosphorylation IGI 19913511
GO:0001933 Process Negative regulation of protein phosphorylation IMP 19913511
GO:0003779 Function Actin binding IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
605269 2254 ENSG00000110880
Protein
UniProt ID Q9ULV4
Protein name Coronin-1C (Coronin-3) (hCRNN4)
Protein function Plays a role in directed cell migration by regulating the activation and subcellular location of RAC1 (PubMed:25074804, PubMed:25925950). Increases the presence of activated RAC1 at the leading edge of migrating cells (PubMed:25074804, PubMed:25
PDB 7STY
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF08953 DUF1899 3 68 Domain of unknown function (DUF1899) Domain
PF00400 WD40 69 109 WD domain, G-beta repeat Repeat
PF00400 WD40 120 159 WD domain, G-beta repeat Repeat
PF00400 WD40 167 202 WD domain, G-beta repeat Repeat
PF16300 WD40_4 343 385 Repeat
Tissue specificity TISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:10828594}.
Sequence
MRRVVRQSKFRHVFGQAVKNDQCYDDIRVSRVTWDSSFCAVNPRFVAIIIEASGGGAFLV
LPLHKTGR
IDKSYPTVCGHTGPVLDIDWCPHNDQVIASGSEDCTVMVWQIPENGLTLSLT
EPVVILEGHSKRVGIVAWHPTARNVLLSAGCDNAIIIWN
VGTGEALINLDDMHSDMIYNV
SWNRNGSLICTASKDKKVRVID
PRKQEIVAEKEKAHEGARPMRAIFLADGNVFTTGFSRM
SERQLALWNPKNMQEPIALHEMDTSNGVLLPFYDPDTSIIYLCGKGDSSIRYFEITDESP
YVHYLNTFSSKEPQRGMGYMPKRGLDVNKCEIARFFKLHERKCEPIIMTVPRKSDLFQDD
LYPDTAGPEAALEAEEWFEGKNADP
ILISLKHGYIPGKNRDLKVVKKNILDSKPTANKKC
DLISIPKKTTDTASVQNEAKLDEILKEIKSIKDTICNQDERISKLEQQMAKIAA
Sequence length 474
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Coronary artery disease Coronary artery disease N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Alzheimer Disease Associate 33878365
Brain Neoplasms Associate 40596133
Breast Neoplasms Associate 28302118, 30150608, 30974047
Carcinoma Pancreatic Ductal Associate 37239355
Carcinoma Renal Cell Associate 32556891
Carcinoma Squamous Cell Associate 30974047
Glioblastoma Stimulate 40596133
Lymphatic Metastasis Associate 30974047
Lymphoma Associate 34166375
Medulloblastoma Stimulate 40596133