Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
23590
Gene name Gene Name - the full gene name approved by the HGNC.
Decaprenyl diphosphate synthase subunit 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
PDSS1
Synonyms (NCBI Gene) Gene synonyms aliases
COQ1, COQ10D2, COQ1A, DPS, SPS, TPRT, TPT, TPT 1, hDPS1
Chromosome Chromosome number
10
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
10p12.1
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is an enzyme that elongates the prenyl side-chain of coenzyme Q, or ubiquinone, one of the key elements in the respiratory chain. The gene product catalyzes the formation of all trans-polyprenyl pyrophosphates from isopent
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs119463988 T>A,G Pathogenic Missense variant, non coding transcript variant, coding sequence variant, intron variant
rs863224162 G>T Likely-pathogenic Intron variant, upstream transcript variant, genic upstream transcript variant
rs863224163 C>- Pathogenic Non coding transcript variant, coding sequence variant, intron variant, frameshift variant
rs1057519353 ->T Pathogenic Frameshift variant, non coding transcript variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT019328 hsa-miR-148b-3p Microarray 17612493
MIRT022672 hsa-miR-124-3p Microarray 18668037
MIRT027634 hsa-miR-98-5p Microarray 19088304
MIRT044710 hsa-miR-320a CLASH 23622248
MIRT044367 hsa-miR-106b-5p CLASH 23622248
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0004659 Function Prenyltransferase activity IBA
GO:0004659 Function Prenyltransferase activity IEA
GO:0005515 Function Protein binding IPI 16262699
GO:0005739 Component Mitochondrion HTP 34800366
GO:0005739 Component Mitochondrion IBA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
607429 17759 ENSG00000148459
Protein
UniProt ID Q5T2R2
Protein name All trans-polyprenyl-diphosphate synthase PDSS1 (All-trans-decaprenyl-diphosphate synthase subunit 1) (EC 2.5.1.91) (Decaprenyl pyrophosphate synthase subunit 1) (Decaprenyl-diphosphate synthase subunit 1) (Solanesyl-diphosphate synthase subunit 1) (Trans
Protein function Heterotetrameric enzyme that catalyzes the condensation of farnesyl diphosphate (FPP), which acts as a primer, and isopentenyl diphosphate (IPP) to produce prenyl diphosphates of varying chain lengths and participates in the determination of the
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00348 polyprenyl_synt 118 367 Polyprenyl synthetase Domain
Sequence
MASRWWRWRRGCSWKPAARSPGPGSPGRAGPLGPSAAAEVRAQVHRRKGLDLSQIPYINL
VKHLTSACPNVCRISRFHHTTPDSKTHSGEKYTDPFKLGWRDLKGLYEDIRKELLISTSE
LKEMSEYYFDGKGKAFRPIIVALMARACNIHHNNSRHVQASQRAIALIAEMIHTASLVHD
DVIDDASSRRGKHTVNKIWGEKKAVLAGDLILSAASIALARIGNTTVISILTQVIEDLVR
GEFLQLGSKENENERFAHYLEKTFKKTASLIANSCKAVSVLGCPDPVVHEIAYQYGKNVG
IAFQLIDDVLDFTSCSDQMGKPTSADLKLGLATGPVLFACQQFPEMNAMIMRRFSLPGDV
DRARQYV
LQSDGVQQTTYLAQQYCHEAIREISKLRPSPERDALIQLSEIVLTRDK
Sequence length 415
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Terpenoid backbone biosynthesis   Ubiquinol biosynthesis
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Deafness-Encephaloneuropathy-Obesity-Valvulopathy Syndrome deafness-encephaloneuropathy-obesity-valvulopathy syndrome rs119463988, rs1057519354 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Coenzyme Q10 Deficiency coenzyme q10 deficiency N/A N/A ClinVar
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Carcinoma Hepatocellular Associate 32887635
Cerebellar Diseases Associate 19096106
Coenzyme Q10 Deficiency Associate 17332895
Coenzyme Q10 Deficiency Stimulate 19096106
Diabetes Mellitus Type 2 Associate 21423737
Eye Diseases Associate 36420660
Hearing Loss Sensorineural Associate 33285023
Hypoxia Associate 32887635
Immunologic Deficiency Syndromes Associate 33285023
Melanoma Cutaneous Malignant Associate 32232919