Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
23589
Gene name Gene Name - the full gene name approved by the HGNC.
Calcium regulated heat stable protein 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CARHSP1
Synonyms (NCBI Gene) Gene synonyms aliases
CRHSP-24, CRHSP24, CSDC1
Chromosome Chromosome number
16
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
16p13.2
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT001645 hsa-let-7b-5p pSILAC 18668040
MIRT020567 hsa-miR-155-5p Reporter assay;Other 20584899
MIRT001645 hsa-let-7b-5p Proteomics;Other 18668040
MIRT052503 hsa-let-7a-5p CLASH 23622248
MIRT052503 hsa-let-7a-5p CLASH 23622248
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000177 Component Cytoplasmic exosome (RNase complex) IEA
GO:0000177 Component Cytoplasmic exosome (RNase complex) ISS
GO:0000932 Component P-body IEA
GO:0003676 Function Nucleic acid binding IEA
GO:0003723 Function RNA binding IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
616885 17150 ENSG00000153048
Protein
UniProt ID Q9Y2V2
Protein name Calcium-regulated heat-stable protein 1 (Calcium-regulated heat-stable protein of 24 kDa) (CRHSP-24)
Protein function Binds mRNA and regulates the stability of target mRNA. Binds single-stranded DNA (in vitro).
PDB 3AQQ
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00313 CSD 63 129 Domain
Sequence
MSSEPPPPPQPPTHQASVGLLDTPRSRERSPSPLRGNVVPSPLPTRRTRTFSATVRASQG
PVYKGVCKCFCRSKGHGFITPADGGPDIFLHISDVEGEYVPVEGDEVTYKMCSIPPKNEK
LQAVEVVIT
HLAPGTKHETWSGHVISS
Sequence length 147
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Glioblastoma Glioblastoma CARHSP1 mRNA level was upregulated in irradiation-resistant GBM cells and knockdown of CARHSP1 sensitized GBM cells to radiotherapy. 34290231 CBGDA
Intracranial Aneurysm Intracranial aneurysm N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Alzheimer Disease Associate 34937778
Atherosclerosis Associate 26899994
Glioblastoma Stimulate 34290231
Infarction Associate 34937778
Infertility Male Associate 34604380
Inflammation Stimulate 34290231
Lewy Body Disease Associate 34937778