Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
23567
Gene name Gene Name - the full gene name approved by the HGNC.
Zinc finger protein 346
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
ZNF346
Synonyms (NCBI Gene) Gene synonyms aliases
JAZ, Zfp346
Chromosome Chromosome number
5
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
5q35.2
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a nucleolar, zinc finger protein that preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids, rather than DNA alone. Mutational studies indicate that the zinc finger domains are not only essential for dsRNA
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT024584 hsa-miR-215-5p Microarray 19074876
MIRT026748 hsa-miR-192-5p Microarray 19074876
MIRT050336 hsa-miR-25-3p CLASH 23622248
MIRT045438 hsa-miR-149-5p CLASH 23622248
MIRT1522952 hsa-miR-1238 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0003723 Function RNA binding HDA 22681889
GO:0003725 Function Double-stranded RNA binding IBA 21873635
GO:0003725 Function Double-stranded RNA binding IDA 10488071
GO:0005515 Function Protein binding IPI 21903422, 25416956, 32296183, 32814053
GO:0005634 Component Nucleus IDA 10488071
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
605308 16403 ENSG00000113761
Protein
UniProt ID Q9UL40
Protein name Zinc finger protein 346 (Just another zinc finger protein)
Protein function Binds with low affinity to dsDNA and ssRNA, and with high affinity to dsRNA, with no detectable sequence specificity (PubMed:24521053). May bind to specific miRNA hairpins (PubMed:28431233). {ECO:0000269|PubMed:24521053, ECO:0000269|PubMed:28431
PDB 2MKD , 2MKN
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF12874 zf-met 73 97 Domain
PF12874 zf-met 135 158 Domain
PF12874 zf-met 185 209 Domain
PF12874 zf-met 239 263 Domain
Sequence
MEYPAPATVQAADGGAAGPYSSSELLEGQEPDGVRFDRERARRLWEAVSGAQPVGREEVE
HMIQKNQCLFTNTQCKVCCALLISESQKLAHYQSKKHANKVKRYLAIHGMETLKGETKKL
DSDQKSSRSKDKNQCCPICNMTFSSPVVAQSHYLGKTHAKNLKLKQQSTKVEALHQNREM
IDPDKFCSLCHATFNDPVMAQQHYVGKKHRKQETKLKLMARYGRLADPAVTDFPAGKGYP
CKTCKIVLNSIEQYQAHVSGFKH
KNQSPKTVASSLGQIPMQRQPIQKDSTTLED
Sequence length 294
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Unknown
Disease term Disease name Evidence References Source
Uterine Fibroids Uterine Fibroids GWAS
Diabetes Diabetes GWAS
Insomnia Insomnia GWAS
Associations from Text Mining
Disease Name Relationship Type References
Carcinoma Hepatocellular Associate 36834567
Gout Associate 35813414
Hepatitis B Stimulate 36834567
Inflammation Associate 36834567
Neoplasms Associate 36834567
Neuroblastoma Associate 29793538