Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	23564
Gene name Gene Name - the full gene name approved by the HGNC.	DDAH family member 2, ADMA-independent
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	DDAH2
Synonyms (NCBI Gene) Gene synonyms aliases	DDAH, DDAHII, G6a, HEL-S-277, NG30
Chromosome Chromosome number	6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	6p21.33
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a dimethylarginine dimethylaminohydrolase. The encoded enzyme functions in nitric oxide generation by regulating the cellular concentrations of methylarginines, which in turn inhibit nitric oxide synthase activity. The protein may be loc

Show/Hide all(50)

miRTarBase ID	miRNA	Experiments	Reference
MIRT025565	hsa-miR-34a-5p	Proteomics	21566225
MIRT928703	hsa-miR-1321	CLIP-seq
MIRT928704	hsa-miR-3130-5p	CLIP-seq
MIRT928705	hsa-miR-331-3p	CLIP-seq
MIRT928706	hsa-miR-3681	CLIP-seq
MIRT928707	hsa-miR-3922-5p	CLIP-seq
MIRT928708	hsa-miR-3974	CLIP-seq
MIRT928709	hsa-miR-4251	CLIP-seq
MIRT928710	hsa-miR-4303	CLIP-seq
MIRT928711	hsa-miR-4329	CLIP-seq
MIRT928712	hsa-miR-4419a	CLIP-seq
MIRT928713	hsa-miR-4435	CLIP-seq
MIRT928714	hsa-miR-4446-5p	CLIP-seq
MIRT928715	hsa-miR-4482	CLIP-seq
MIRT928716	hsa-miR-4510	CLIP-seq
MIRT928717	hsa-miR-4530	CLIP-seq
MIRT928718	hsa-miR-4739	CLIP-seq
MIRT928719	hsa-miR-4753-5p	CLIP-seq
MIRT928720	hsa-miR-4755-3p	CLIP-seq
MIRT928721	hsa-miR-4755-5p	CLIP-seq
MIRT928722	hsa-miR-4756-5p	CLIP-seq
MIRT928723	hsa-miR-501-5p	CLIP-seq
MIRT928724	hsa-miR-659	CLIP-seq
MIRT1975048	hsa-miR-1179	CLIP-seq
MIRT1975049	hsa-miR-150	CLIP-seq
MIRT1975050	hsa-miR-4291	CLIP-seq
MIRT1975051	hsa-miR-4310	CLIP-seq
MIRT1975052	hsa-miR-4461	CLIP-seq
MIRT1975053	hsa-miR-4684-5p	CLIP-seq
MIRT1975054	hsa-miR-4713-5p	CLIP-seq
MIRT1975055	hsa-miR-532-3p	CLIP-seq
MIRT1975056	hsa-miR-606	CLIP-seq
MIRT928703	hsa-miR-1321	CLIP-seq
MIRT928704	hsa-miR-3130-5p	CLIP-seq
MIRT2210454	hsa-miR-3162-3p	CLIP-seq
MIRT2210455	hsa-miR-361-3p	CLIP-seq
MIRT928706	hsa-miR-3681	CLIP-seq
MIRT928709	hsa-miR-4251	CLIP-seq
MIRT928710	hsa-miR-4303	CLIP-seq
MIRT928711	hsa-miR-4329	CLIP-seq
MIRT928712	hsa-miR-4419a	CLIP-seq
MIRT928714	hsa-miR-4446-5p	CLIP-seq
MIRT928715	hsa-miR-4482	CLIP-seq
MIRT928716	hsa-miR-4510	CLIP-seq
MIRT2210456	hsa-miR-4639-3p	CLIP-seq
MIRT928718	hsa-miR-4739	CLIP-seq
MIRT928721	hsa-miR-4755-5p	CLIP-seq
MIRT928722	hsa-miR-4756-5p	CLIP-seq
MIRT928723	hsa-miR-501-5p	CLIP-seq
MIRT928724	hsa-miR-659	CLIP-seq

Show/Hide all(13)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000052	Process	Citrulline metabolic process	IDA	21493890, 37296100
GO:0005515	Function	Protein binding	IPI	16189514, 19060904, 22046132, 32296183, 33961781
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IDA
GO:0005739	Component	Mitochondrion	IEA
GO:0016403	Function	Dimethylargininase activity	IDA	21493890, 37296100
GO:0016403	Function	Dimethylargininase activity	IGI	37296100
GO:0016403	Function	Dimethylargininase activity	IKR	37296100
GO:0016403	Function	Dimethylargininase activity	IMP	37296100
GO:0016787	Function	Hydrolase activity	IEA
GO:0043066	Process	Negative regulation of apoptotic process	TAS	16130169
GO:0045429	Process	Positive regulation of nitric oxide biosynthetic process	ISS
GO:0070062	Component	Extracellular exosome	HDA	19056867, 23533145

MIM	HGNC	e!Ensembl
604744	2716	ENSG00000213722

Protein

UniProt ID

O95865

Protein name

Putative hydrolase DDAH2 (EC 3.-.-.-) (DDAHII) (Inactive N(G),N(G)-dimethylarginine dimethylaminohydrolase 2) (DDAH-2) (Inactive dimethylarginine dimethylaminohydrolase 2) (Protein G6a) (S-phase protein)

Protein function

Putative hydrolase with unknown substrate (Probable). Does not hydrolyze N(G),N(G)-dimethyl-L-arginine (ADMA) which acts as an inhibitor of NOS (PubMed:21493890, PubMed:37296100). In endothelial cells, induces expression of vascular endothelial

Family and domains

Tissue specificity

TISSUE SPECIFICITY: Detected in heart, placenta, lung, liver, skeletal muscle, kidney and pancreas, and at very low levels in brain. {ECO:0000269|PubMed:10493931}.

Sequence

MGTPGEGLGRCSHALIRGVPESLASGEGAGAGLPALDLAKAQREHGVLGGKLRQRLGLQL
LELPPEESLPLGPLLGDTAVIQGDTALITRPWSPARRPEVDGVRKALQDLGLRIVEIGDE
NATLDGTDVLFTGREFFVGLSKWTNHRGAEIVADTFRDFAVSTVPVSGPSHLRGLCGMGG
PRTVVAGSSDAAQKAVRAMAVLTDHPYASLTLPDDAAADCLFLRPGLPGVPPFLLHRGGG
DLPNSQEALQKLSDVTLVPVSCSELEKAGAGLSSLCLVLSTRPHS

Sequence length

285

Interactions

View interactions

	Reactome
			eNOS activation

DDAH2 (DDAH family member 2, ADMA-independent)