Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	23552
Gene name Gene Name - the full gene name approved by the HGNC.	Cyclin dependent kinase 20
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	CDK20
Synonyms (NCBI Gene) Gene synonyms aliases	CCRK, CDCH, P42, PNQALRE
Chromosome Chromosome number	9
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	9q22.1
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene contains a kinase domain most closely related to the cyclin-dependent protein kinases. The encoded kinase may activate cyclin-dependent kinase 2 and is involved in cell growth. Alternatively spliced transcript variants enc

Show/Hide all(2)

SNP ID	Visualize variation	Clinical significance	Consequence
rs745561217	A>G	Likely-pathogenic	Missense variant, non coding transcript variant, coding sequence variant, intron variant
rs1057519438	C>G,T	Pathogenic	Intron variant, missense variant, coding sequence variant, stop gained, synonymous variant, non coding transcript variant

Show/Hide all(51)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017181	hsa-miR-335-5p	Microarray	18185580
MIRT039839	hsa-miR-615-3p	CLASH	23622248
MIRT880945	hsa-miR-450b-3p	CLIP-seq
MIRT880946	hsa-miR-4661-5p	CLIP-seq
MIRT880947	hsa-miR-769-3p	CLIP-seq
MIRT2500978	hsa-miR-1208	CLIP-seq
MIRT2500979	hsa-miR-1225-5p	CLIP-seq
MIRT2500980	hsa-miR-124	CLIP-seq
MIRT2500981	hsa-miR-1243	CLIP-seq
MIRT2500982	hsa-miR-1292	CLIP-seq
MIRT2500983	hsa-miR-1972	CLIP-seq
MIRT2500984	hsa-miR-199a-3p	CLIP-seq
MIRT2500985	hsa-miR-199b-3p	CLIP-seq
MIRT2500986	hsa-miR-2117	CLIP-seq
MIRT2500987	hsa-miR-3129-5p	CLIP-seq
MIRT2500988	hsa-miR-342-3p	CLIP-seq
MIRT2500989	hsa-miR-3622a-3p	CLIP-seq
MIRT2500990	hsa-miR-3622b-3p	CLIP-seq
MIRT2500991	hsa-miR-3652	CLIP-seq
MIRT2500992	hsa-miR-3670	CLIP-seq
MIRT2500993	hsa-miR-3714	CLIP-seq
MIRT2500994	hsa-miR-3910	CLIP-seq
MIRT2500995	hsa-miR-3921	CLIP-seq
MIRT2500996	hsa-miR-4251	CLIP-seq
MIRT2500997	hsa-miR-4255	CLIP-seq
MIRT2500998	hsa-miR-4273	CLIP-seq
MIRT2500999	hsa-miR-4279	CLIP-seq
MIRT2501000	hsa-miR-4284	CLIP-seq
MIRT2501001	hsa-miR-4329	CLIP-seq
MIRT2501002	hsa-miR-4430	CLIP-seq
MIRT2501003	hsa-miR-4471	CLIP-seq
MIRT2501004	hsa-miR-4505	CLIP-seq
MIRT2501005	hsa-miR-4539	CLIP-seq
MIRT2501006	hsa-miR-4646-5p	CLIP-seq
MIRT2501007	hsa-miR-4653-5p	CLIP-seq
MIRT2501008	hsa-miR-4724-5p	CLIP-seq
MIRT2501009	hsa-miR-4764-5p	CLIP-seq
MIRT2501010	hsa-miR-4786-5p	CLIP-seq
MIRT2501011	hsa-miR-506	CLIP-seq
MIRT2501012	hsa-miR-544b	CLIP-seq
MIRT2501013	hsa-miR-548aa	CLIP-seq
MIRT2501014	hsa-miR-548ag	CLIP-seq
MIRT2501015	hsa-miR-548ai	CLIP-seq
MIRT2501016	hsa-miR-580	CLIP-seq
MIRT2501017	hsa-miR-598	CLIP-seq
MIRT2501018	hsa-miR-647	CLIP-seq
MIRT2501019	hsa-miR-760	CLIP-seq
MIRT2501020	hsa-miR-767-3p	CLIP-seq
MIRT2501021	hsa-miR-885-3p	CLIP-seq
MIRT2501022	hsa-miR-922	CLIP-seq
MIRT2501023	hsa-miR-936	CLIP-seq

Transcription factors

Show/Hide all(2)

Transcription factor	Regulation	Reference
AR	Activation	21747169
AR	Activation	21747169

Show/Hide all(29)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0001843	Process	Neural tube closure	IEA
GO:0004672	Function	Protein kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	IBA
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004693	Function	Cyclin-dependent protein serine/threonine kinase activity	IEA
GO:0005515	Function	Protein binding	IPI	21986944, 26871637
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IEA
GO:0005794	Component	Golgi apparatus	IDA
GO:0005929	Component	Cilium	IEA
GO:0008589	Process	Regulation of smoothened signaling pathway	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0021508	Process	Floor plate formation	IEA
GO:0031076	Process	Embryonic camera-type eye development	IEA
GO:0042995	Component	Cell projection	IEA
GO:0045879	Process	Negative regulation of smoothened signaling pathway	IEA
GO:0048706	Process	Embryonic skeletal system development	IEA
GO:0051301	Process	Cell division	IEA
GO:0051726	Process	Regulation of cell cycle	IEA
GO:0060021	Process	Roof of mouth development	IEA
GO:0061512	Process	Protein localization to cilium	IEA
GO:0106310	Function	Protein serine kinase activity	IEA
GO:1903317	Process	Regulation of protein maturation	IEA
GO:1990403	Process	Embryonic brain development	IEA

MIM	HGNC	e!Ensembl
610076	21420	ENSG00000156345

Protein

UniProt ID

Q8IZL9

Protein name

Cyclin-dependent kinase 20 (EC 2.7.11.22) (CDK-activating kinase p42) (CAK-kinase p42) (Cell cycle-related kinase) (Cell division protein kinase 20) (Cyclin-dependent protein kinase H) (Cyclin-kinase-activating kinase p42)

Protein function

Required for high-level Shh responses in the developing neural tube. Together with TBC1D32, controls the structure of the primary cilium by coordinating assembly of the ciliary membrane and axoneme, allowing GLI2 to be properly activated in resp

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00069	Pkinase	4 → 288	Protein kinase domain	Domain

Sequence

MDQYCILGRIGEGAHGIVFKAKHVETGEIVALKKVALRRLEDGFPNQALREIKALQEMED
NQYVVQLKAVFPHGGGFVLAFEFMLSDLAEVVRHAQRPLAQAQVKSYLQMLLKGVAFCHA
NNIVHRDLKPANLLISASGQLKIADFGLARVFSPDGSRLYTHQVATRWYRAPELLYGARQ
YDQGVDLWSVGCIMGELLNGSPLFPGKNDIEQLCYVLRILGTPNPQVWPELTELPDYNKI
SFKEQVPMPLEEVLPDVSPQALDLLGQFLLYPPHQRIAASKALLHQYFFTAPLPAHPSEL
PIPQRLGGPAPKAHPGPPHIHDFHVDRPLEESLLNPELIRPFILEG

Sequence length

346

Interactions

View interactions

Show/Hide Unknown Diseases (2)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Nephrotic Syndrome	nephrotic syndrome	N/A	N/A	ClinVar
Neurodevelopmental Disorders	complex neurodevelopmental disorder	N/A	N/A	GenCC

Show/Hide Text Mining Associations (22)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Anemia Hemolytic Autoimmune	Associate	2179128
Breast Neoplasms	Associate	23380370, 9729531, 9813039
Carcinoma Hepatocellular	Associate	15040022
Carcinoma Non Small Cell Lung	Associate	21336985
Carcinoma Non Small Cell Lung	Inhibit	24998263
Cell Transformation Neoplastic	Associate	24998263
Colonic Neoplasms	Associate	10097131
Fibrosis	Associate	26088859
Hashimoto Disease	Associate	37545519
Insulin Resistance	Associate	23468892
Leukemia Myeloid Acute	Associate	37532789
Lymphoma Large Cell Anaplastic	Associate	19531656
Neoplasm Metastasis	Associate	21336985
Neoplasms	Associate	10097131, 11078722, 9874674
Neoplasms	Inhibit	19331166, 24998263
Obesity	Associate	23468892
Osteosarcoma	Associate	24391455, 32665038
Pancreatic Neoplasms	Associate	15969750
Polycystic Ovary Syndrome	Associate	37545519
Prostatic Neoplasms	Associate	18787043
Squamous Cell Carcinoma of Head and Neck	Associate	19331166
Vulvar Neoplasms	Associate	10799446

CDK20 (cyclin dependent kinase 20)