LILRA4 (leukocyte immunoglobulin like receptor A4)

Gene
Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
23547
Gene name Gene Name - the full gene name approved by the HGNC.
Leukocyte immunoglobulin like receptor A4
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
LILRA4
Synonyms (NCBI Gene) Gene synonyms aliases
CD85g, ILT7
Chromosome Chromosome number
19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
19q13.42
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes an immunoglobulin-like cell surface protein that is expressed predominantly on plasmacytoid dendritic cells (PDCs) and modulates the function of these cells in the immune response. Expression of this gene is downregulated by interleukin
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Pathways
Show/Hide all(1)
miRTarBase ID miRNA Experiments Reference
MIRT028869 hsa-miR-26b-5p Microarray 19088304
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Pathways
Show/Hide all(11)
GO ID Ontology Definition Evidence Reference
GO:0005102 Function Signaling receptor binding IPI 16735691
GO:0005515 Function Protein binding IPI 19564354
GO:0005887 Component Integral component of plasma membrane IDA 16735691
GO:0015026 Function Coreceptor activity IDA 16735691
GO:0032687 Process Negative regulation of interferon-alpha production IMP 16735691
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Pathways
MIM HGNC e!Ensembl
607517 15503 ENSG00000239961
Protein
Gene miRNA Gene ontology Other IDs Protein Pathways
UniProt ID P59901
Protein name Leukocyte immunoglobulin-like receptor subfamily A member 4 (CD85 antigen-like family member G) (Immunoglobulin-like transcript 7) (ILT-7) (CD antigen CD85g)
Protein function Functions coreceptor to limit the innate immune responses to viral infections; signaling occurs via FCER1G (PubMed:16735691, PubMed:19564354). Down-regulates the production of IFNA1, IFNA2, IFNA4, IFNB1 and TNF by plasmacytoid dendritic cells th
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13895 Ig_2 28 → 117 Immunoglobulin domain Domain
PF00047 ig 126 → 210 Immunoglobulin domain Domain
PF13895 Ig_2 323 → 417 Immunoglobulin domain Domain
Tissue specificity TISSUE SPECIFICITY: Detected on plasmacytoid dendritic cells (at protein level). Detected on plasmacytoid dendritic cells, but not on monocytes or B cells. {ECO:0000269|PubMed:16735691}.
Sequence 
MTLILTSLLFFGLSLGPRTRVQAENLPKPILWAEPGPVITWHNPVTIWCQGTLEAQGYRL
DKEGNSMSRHILKTLESENKVKLSIPSMMWEHAGRYHCYYQSPAGWSEPSDPLELVVTAY
SRPTLSALPSPVVTSGVNVTLRCASRLGLGRFTLIEEGDHRLSWTLNSHQHNHGKFQALF
PMGPLTFSNRGTFRCYGYENNTPYVWSEPSDPLQLLVSGVSRKPSLLTLQGPVVTPGENL
TLQCGSDVGYIRYTLYKEGADGLPQRPGRQPQAGLSQANFTLSPVSRSYGGQYRCYGAHN
VSSEWSAPSDPLDILIAGQISDRPSLSVQPGPTVTSGEKVTLLCQSWDPMFTFLLTKEGA
AHPPLRLRSMYGAHKYQAEFPMSPVTSAHAGTYRCYGSRSSNPYLLSHPSEPLELVVSGA
TETLNPAQKKSDSKTAPHLQDYTVENLIRMGVAGLVLLFLGILLFEAQHSQRSPPRCSQE
ANSRKDNAPFRVVEPWEQI
Sequence length 499
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways
  KEGG   Reactome
  Osteoclast differentiation
B cell receptor signaling pathway 		  Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell