LILRA4 (leukocyte immunoglobulin like receptor A4)

Gene

• Entrez ID: 23547
• Gene name: Leukocyte immunoglobulin like receptor A4
• Gene symbol: LILRA4
• Synonyms (NCBI Gene): CD85g, ILT7
• Chromosome: 19
• Chromosome location: 19q13.42
• Summary: This gene encodes an immunoglobulin-like cell surface protein that is expressed predominantly on plasmacytoid dendritic cells (PDCs) and modulates the function of these cells in the immune response. Expression of this gene is downregulated by interleukin

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT028869	hsa-miR-26b-5p	Microarray	19088304

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002376	Process	Immune system process	IEA
GO:0002764	Process	Immune response-regulating signaling pathway	IBA
GO:0005102	Function	Signaling receptor binding	IPI	16735691
GO:0005515	Function	Protein binding	IPI	19564354
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	16735691
GO:0005886	Component	Plasma membrane	IEA
GO:0007166	Process	Cell surface receptor signaling pathway	IEA
GO:0015026	Function	Coreceptor activity	IDA	16735691
GO:0016020	Component	Membrane	IEA
GO:0019221	Process	Cytokine-mediated signaling pathway	IBA
GO:0032396	Function	Inhibitory MHC class I receptor activity	IBA
GO:0032687	Process	Negative regulation of interferon-alpha production	IMP	16735691
GO:0032720	Process	Negative regulation of tumor necrosis factor production	IMP	16735691
GO:0032998	Component	Fc-epsilon receptor I complex	IDA	16735691
GO:0034156	Process	Negative regulation of toll-like receptor 7 signaling pathway	IMP	16735691
GO:0034164	Process	Negative regulation of toll-like receptor 9 signaling pathway	IMP	16735691
GO:0038095	Process	Fc-epsilon receptor signaling pathway	IMP	16735691
GO:0045087	Process	Innate immune response	IEA

Other IDs

• MIM: 607517
• HGNC: 15503
• e!Ensembl: ENSG00000239961

Protein

• UniProt ID: P59901
• Protein name: Leukocyte immunoglobulin-like receptor subfamily A member 4 (CD85 antigen-like family member G) (Immunoglobulin-like transcript 7) (ILT-7) (CD antigen CD85g)
• Protein function: Functions coreceptor to limit the innate immune responses to viral infections; signaling occurs via FCER1G (PubMed:16735691, PubMed:19564354). Down-regulates the production of IFNA1, IFNA2, IFNA4, IFNB1 and TNF by plasmacytoid dendritic cells th
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF13895	Ig_2	28 → 117	Immunoglobulin domain	Domain
  PF00047	ig	126 → 210	Immunoglobulin domain	Domain
  PF13895	Ig_2	323 → 417	Immunoglobulin domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Detected on plasmacytoid dendritic cells (at protein level). Detected on plasmacytoid dendritic cells, but not on monocytes or B cells. {ECO:0000269|PubMed:16735691}.
• Sequence:

  MTLILTSLLFFGLSLGPRTRVQAENLPKPILWAEPGPVITWHNPVTIWCQGTLEAQGYRL
  DKEGNSMSRHILKTLESENKVKLSIPSMMWEHAGRYHCYYQSPAGWSEPSDPLELVVTAY
  SRPTLSALPSPVVTSGVNVTLRCASRLGLGRFTLIEEGDHRLSWTLNSHQHNHGKFQALF
  PMGPLTFSNRGTFRCYGYENNTPYVWSEPSDPLQLLVSGVSRKPSLLTLQGPVVTPGENL
  TLQCGSDVGYIRYTLYKEGADGLPQRPGRQPQAGLSQANFTLSPVSRSYGGQYRCYGAHN
  VSSEWSAPSDPLDILIAGQISDRPSLSVQPGPTVTSGEKVTLLCQSWDPMFTFLLTKEGA
  AHPPLRLRSMYGAHKYQAEFPMSPVTSAHAGTYRCYGSRSSNPYLLSHPSEPLELVVSGA
  TETLNPAQKKSDSKTAPHLQDYTVENLIRMGVAGLVLLFLGILLFEAQHSQRSPPRCSQE
  ANSRKDNAPFRVVEPWEQI

• Sequence length: 499

Pathways

KEGG:

Osteoclast differentiation
B cell receptor signaling pathway

Reactome:

Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
AUTOIMMUNE HEPATITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEUKEMIA, LYMPHOCYTIC, CHRONIC, B-CELL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Relationship Type	References	Evidence Score
Pemphigus	Associate	30216441	★☆☆☆☆ Found in Text Mining only