FOSB (FosB proto-oncogene, AP-1 transcription factor subunit)

Gene
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
2354
Gene name Gene Name - the full gene name approved by the HGNC.
FosB proto-oncogene, AP-1 transcription factor subunit
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
FOSB
Synonyms (NCBI Gene) Gene synonyms aliases
AP-1, G0S3, GOS3, GOSB
Chromosome Chromosome number
19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
19q13.32
Summary Summary of gene provided in NCBI Entrez Gene.
The Fos gene family consists of 4 members: FOS, FOSB, FOSL1, and FOSL2. These genes encode leucine zipper proteins that can dimerize with proteins of the JUN family, thereby forming the transcription factor complex AP-1. As such, the FOS proteins have bee
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(43)
miRTarBase ID miRNA Experiments Reference
MIRT003234 hsa-miR-224-5p Luciferase reporter assay 20065103
MIRT006087 hsa-miR-663a Microarray, qRT-PCR 21378144
MIRT006087 hsa-miR-663a Microarray, qRT-PCR 21378144
MIRT006087 hsa-miR-663a Microarray, qRT-PCR 21378144
MIRT1001127 hsa-miR-139-3p CLIP-seq
Transcription factors
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(1)
Transcription factor Regulation Reference
STAT6 Unknown 18342537
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(27)
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II TAS 1900040
GO:0000785 Component Chromatin ISA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA 21873635
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA 21873635
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific ISA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
164772 3797 ENSG00000125740
Protein
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID P53539
Protein name Protein FosB (FosB proto-oncogene, AP-1 transcription factor subunit) (G0/G1 switch regulatory protein 3) (Transcription factor AP-1 subunit FosB)
Protein function Heterodimerizes with proteins of the JUN family to form an AP-1 transcription factor complex, thereby enhancing their DNA binding activity to gene promoters containing an AP-1 consensus sequence 5'-TGA[GC]TCA-3' and enhancing their transcription
PDB 5VPA , 5VPB , 5VPC , 5VPD , 5VPE , 5VPF , 6UCI , 6UCL , 6UCM , 7UCC , 7UCD
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00170 bZIP_1 153 → 213 bZIP transcription factor Coiled-coil
Tissue specificity TISSUE SPECIFICITY: [Isoform 11]: Expressed in the nucleus accumbens of the striatum (at protein level). {ECO:0000269|PubMed:20473292}.
Sequence 
MFQAFPGDYDSGSRCSSSPSAESQYLSSVDSFGSPPTAAASQECAGLGEMPGSFVPTVTA
ITTSQDLQWLVQPTLISSMAQSQGQPLASQPPVVDPYDMPGTSYSTPGMSGYSSGGASGS
GGPSTSGTTSGPGPARPARARPRRPREETLTPEEEEKRRVRRERNKLAAAKCRNRRRELT
DRLQAETDQLEEEKAELESEIAELQKEKERLEFVLVAHKPGCKIPYEEGPGPGPLAEVRD
LPGSAPAKEDGFSWLLPPPPPPPLPFQTSQDAPPNLTASLFTHSEVQVLGDPFPVVNPSY
TSSFVLTCPEVSAFAGAQRTSGSDQPSDPLNSPSLLAL
Sequence length 338
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG   Reactome
  Osteoclast differentiation
IL-17 signaling pathway
Cocaine addiction
Amphetamine addiction
Alcoholism 		  Estrogen-dependent gene expression
NGF-stimulated transcription
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Causal Diseases (3)
Causal
Disease term Disease name dbSNP ID References
Arthritis Juvenile arthritis rs1594890601, rs1594882933, rs184370809, rs776489319, rs1594883470 19565504
Epilepsy Epilepsy, Epilepsy, Cryptogenic, Awakening Epilepsy rs113994140, rs28937874, rs1589762127, rs104894166, rs28939075, rs2134001459, rs104894167, rs119488099, rs119488100, rs387906420, rs121917752, rs121918622, rs281865564, rs387907313, rs397514670
View all (165 more)		 16391389
Lung cancer Malignant neoplasm of lung rs121913530, rs121913529, rs878855122, rs1057519784, rs770315135 27935865
Show/Hide Text Mining Associations (81)
Associations from Text Mining
Disease Name Relationship Type References
Adenoma Pleomorphic Associate 25137137
Amyotrophic Lateral Sclerosis Associate 28437540
Aniridia Associate 32422284
Aortic Aneurysm Abdominal Associate 22797469
Aortic Valve Stenosis Associate 39766890
Arthritis Associate 24385683
Blood Coagulation Disorders Associate 34238253
Bone Diseases Associate 33034932
Breast Neoplasms Associate 16984917, 21187089, 25200076, 25991675, 26608367, 31735020, 35037412, 36010586
Carcinoma Embryonal Stimulate 9446552