Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	2354
Gene name Gene Name - the full gene name approved by the HGNC.	FosB proto-oncogene, AP-1 transcription factor subunit
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	FOSB
Synonyms (NCBI Gene) Gene synonyms aliases	AP-1, G0S3, GOS3, GOSB
Chromosome Chromosome number	19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	19q13.32
Summary Summary of gene provided in NCBI Entrez Gene.	The Fos gene family consists of 4 members: FOS, FOSB, FOSL1, and FOSL2. These genes encode leucine zipper proteins that can dimerize with proteins of the JUN family, thereby forming the transcription factor complex AP-1. As such, the FOS proteins have bee

Show/Hide all(43)

miRTarBase ID	miRNA	Experiments	Reference
MIRT003234	hsa-miR-224-5p	Luciferase reporter assay	20065103
MIRT006087	hsa-miR-663a	Microarray, qRT-PCR	21378144
MIRT006087	hsa-miR-663a	Microarray, qRT-PCR	21378144
MIRT006087	hsa-miR-663a	Microarray, qRT-PCR	21378144
MIRT1001127	hsa-miR-139-3p	CLIP-seq
MIRT1001128	hsa-miR-193a-5p	CLIP-seq
MIRT1001129	hsa-miR-2392	CLIP-seq
MIRT1001130	hsa-miR-3192	CLIP-seq
MIRT1001131	hsa-miR-4314	CLIP-seq
MIRT1001132	hsa-miR-450b-3p	CLIP-seq
MIRT1001133	hsa-miR-4646-5p	CLIP-seq
MIRT1001134	hsa-miR-4713-3p	CLIP-seq
MIRT1001135	hsa-miR-4772-5p	CLIP-seq
MIRT1001136	hsa-miR-638	CLIP-seq
MIRT1001137	hsa-miR-769-3p	CLIP-seq
MIRT1001138	hsa-miR-1207-3p	CLIP-seq
MIRT1001139	hsa-miR-1207-5p	CLIP-seq
MIRT1001140	hsa-miR-148a	CLIP-seq
MIRT1001141	hsa-miR-148b	CLIP-seq
MIRT1001142	hsa-miR-152	CLIP-seq
MIRT1001143	hsa-miR-182	CLIP-seq
MIRT1001144	hsa-miR-298	CLIP-seq
MIRT1001145	hsa-miR-3135b	CLIP-seq
MIRT1001146	hsa-miR-4709-5p	CLIP-seq
MIRT1001147	hsa-miR-4736	CLIP-seq
MIRT1001148	hsa-miR-4763-3p	CLIP-seq
MIRT1001139	hsa-miR-1207-5p	CLIP-seq
MIRT1996611	hsa-miR-4279	CLIP-seq
MIRT1001147	hsa-miR-4736	CLIP-seq
MIRT1001148	hsa-miR-4763-3p	CLIP-seq
MIRT1996612	hsa-miR-508-5p	CLIP-seq
MIRT1996613	hsa-miR-766	CLIP-seq
MIRT1001139	hsa-miR-1207-5p	CLIP-seq
MIRT2230627	hsa-miR-1286	CLIP-seq
MIRT1001147	hsa-miR-4736	CLIP-seq
MIRT1001148	hsa-miR-4763-3p	CLIP-seq
MIRT2534700	hsa-miR-3184	CLIP-seq
MIRT2534701	hsa-miR-3936	CLIP-seq
MIRT2534702	hsa-miR-423-5p	CLIP-seq
MIRT2534703	hsa-miR-4434	CLIP-seq
MIRT2534704	hsa-miR-4516	CLIP-seq
MIRT2534705	hsa-miR-4651	CLIP-seq
MIRT2534706	hsa-miR-608	CLIP-seq

Transcription factors

Show/Hide all(1)

Transcription factor	Regulation	Reference
STAT6	Unknown	18342537

Show/Hide all(40)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	TAS	1900040
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA
GO:0001975	Process	Response to amphetamine	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003677	Function	DNA binding	TAS	1900040
GO:0003690	Function	Double-stranded DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0005515	Function	Protein binding	IPI	28514442, 32296183, 32911434, 33961781
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	22387553
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005829	Component	Cytosol	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0006366	Process	Transcription by RNA polymerase II	IEA
GO:0007565	Process	Female pregnancy	IEA
GO:0009410	Process	Response to xenobiotic stimulus	IEA
GO:0009612	Process	Response to mechanical stimulus	IEA
GO:0032570	Process	Response to progesterone	IEA
GO:0032870	Process	Cellular response to hormone stimulus	IEA
GO:0035094	Process	Response to nicotine	IEA
GO:0042220	Process	Response to cocaine	IEA
GO:0043278	Process	Response to morphine	IEA
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0045471	Process	Response to ethanol	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0048148	Process	Behavioral response to cocaine	IEA
GO:0051412	Process	Response to corticosterone	IEA
GO:0051591	Process	Response to cAMP	IEA
GO:0071277	Process	Cellular response to calcium ion	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IEA

MIM	HGNC	e!Ensembl
164772	3797	ENSG00000125740

Protein

UniProt ID

P53539

Protein name

Protein FosB (FosB proto-oncogene, AP-1 transcription factor subunit) (G0/G1 switch regulatory protein 3) (Transcription factor AP-1 subunit FosB)

Protein function

Heterodimerizes with proteins of the JUN family to form an AP-1 transcription factor complex, thereby enhancing their DNA binding activity to gene promoters containing an AP-1 consensus sequence 5'-TGA[GC]TCA-3' and enhancing their transcription

PDB

5VPA , 5VPB , 5VPC , 5VPD , 5VPE , 5VPF , 6UCI , 6UCL , 6UCM , 7UCC , 7UCD

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00170	bZIP_1	153 → 213	bZIP transcription factor	Coiled-coil

Tissue specificity

TISSUE SPECIFICITY: [Isoform 11]: Expressed in the nucleus accumbens of the striatum (at protein level). {ECO:0000269|PubMed:20473292}.

Sequence

MFQAFPGDYDSGSRCSSSPSAESQYLSSVDSFGSPPTAAASQECAGLGEMPGSFVPTVTA
ITTSQDLQWLVQPTLISSMAQSQGQPLASQPPVVDPYDMPGTSYSTPGMSGYSSGGASGS
GGPSTSGTTSGPGPARPARARPRRPREETLTPEEEEKRRVRRERNKLAAAKCRNRRRELT
DRLQAETDQLEEEKAELESEIAELQKEKERLEFVLVAHKPGCKIPYEEGPGPGPLAEVRD
LPGSAPAKEDGFSWLLPPPPPPPLPFQTSQDAPPNLTASLFTHSEVQVLGDPFPVVNPSY
TSSFVLTCPEVSAFAGAQRTSGSDQPSDPLNSPSLLAL

Sequence length

338

Interactions

View interactions

	KEGG		Reactome
	Osteoclast differentiation IL-17 signaling pathway Cocaine addiction Amphetamine addiction Alcoholism		Estrogen-dependent gene expression NGF-stimulated transcription

FOSB (FosB proto-oncogene, AP-1 transcription factor subunit)